Recombinant Dechloromonas aromatica Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

Functional Role in KdpFABC

KdpC acts as a catalytic chaperone, enabling high-affinity potassium transport through:

  • ATP Binding Coordination: ATP binding to KdpC’s soluble domain increases KdpB’s ATPase activity by ~20-fold .

  • Intersubunit Communication: Mediates interactions between KdpB’s nucleotide-binding loop and KdpA’s selectivity filter, facilitating K+ translocation via an intramembrane tunnel .

  • Low Nucleotide Specificity: Binds ATP, ADP, AMP, GTP, and CTP with similar affinity, suggesting regulatory versatility .

Recombinant Production and Applications

While recombinant Dechloromonas aromatica KdpC has not been explicitly documented, homologous KdpC proteins (e.g., Escherichia coli, Pseudomonas entomophila) are typically produced as follows:

Table 2: Recombinant KdpC Production Parameters (Homologs)

ParameterDetailSource
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose; stable at -80°C
  • Functional assays of recombinant KdpC homologs confirm ATPase activation and ion transport coupling .

Research Findings and Mechanistic Insights

  • ATPase Activation: ATP binding to KdpC’s soluble domain reduces the Km of KdpB for ATP from 1.2 mM to 0.06 mM, indicating allosteric regulation .

  • Intersubunit Tunnel: Cryo-EM structures reveal a K+ translocation pathway through KdpA’s selectivity filter to KdpB’s substrate-binding site, with KdpC stabilizing intermediate states .

  • Polarized Cation-π Stacking: A phenylalanine residue at the KdpA-KdpB interface regulates K+ entry into the canonical binding site, ensuring selectivity .

Comparative Analysis with Homologs

Table 3: Functional Conservation Across Bacterial KdpC Subunits

SpeciesKey Residues/FeaturesFunctional Role
Escherichia coliGln161 (ATP binding), Val144-Lys161 peptideATPase activation, ternary complex
Pseudomonas entomophilaConserved LSGGQ motif, His-tag for purificationStructural stabilization
Dechloromonas aromaticaPutative kdpC gene (NCBI: WP_012016608.1)Inferred ATP coordination
  • Dechloromonas aromatica’s genome encodes a putative kdpC gene (NCBI: WP_012016608.1), suggesting functional homology with characterized systems .

Unresolved Questions and Future Directions

  • Direct structural and biochemical studies on Dechloromonas aromatica KdpC are needed to confirm its ATP-binding kinetics and interaction with KdpB.

  • The role of KdpC in Fe(II) or H2S oxidation pathways, unique to Dechloromonas aromatica, remains unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment accordingly.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; Daro_1085; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Dechloromonas aromatica (strain RCB)
Target Names
kdpC
Target Protein Sequence
MKTLLRPAVSLFVLLTAVTGVVYPLAVTGIAKVTFPEAADGSLIVKDGKTVGSSLIGQNF SDPKYFWGRPSATSPMPYNASSSSGSNQGPLNPALVDAVKVRIEALKAADPDNKLPIPAD LVNASASGLDPHISPEAAAYQVTRVAGQRHLLPADVKALVSQHTEGRQWGVFGEPRVNVL QLNIALDSVSK
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Dechloromonas aromatica and why is it significant for research?

Dechloromonas aromatica strain RCB is a unique bacterium capable of oxidizing benzene in the absence of oxygen. This organism can oxidize various aromatic compounds including toluene, benzoate, and chlorobenzoate by coupling growth and benzene oxidation to the reduction of O₂, chlorate, or nitrate. The complete mineralization of benzene to CO₂ makes D. aromatica particularly significant for bioremediation applications targeting benzene contamination, which is a widespread environmental concern in ground and surface waters . The organism's versatile metabolic pathways, including both dioxygenase-based aerobic pathways and uncharacterized anaerobic pathways, make it a valuable model for studying bacterial adaptation to different environmental conditions.

What is the potassium-transporting ATPase system in D. aromatica and what role does the C chain (kdpC) play?

The potassium-transporting ATPase system (Kdp) in D. aromatica, like in other bacteria, is a high-affinity K⁺ uptake system that functions as a P-type ATPase. The system typically consists of three integral membrane proteins: KdpA (the K⁺-binding subunit), KdpB (the catalytic subunit with ATPase activity), and KdpC (the regulatory subunit). Based on what we know about related proteins like KdpB, the KdpC subunit likely plays a crucial regulatory role in the function of the potassium transport complex, influencing ATP hydrolysis and potassium translocation rates . The KdpC chain is believed to modulate the affinity of the complex for potassium ions under different environmental conditions, particularly during osmotic stress.

How does the kdpC protein compare structurally with the better-characterized kdpB protein?

While the KdpB protein is a large transmembrane protein (688 amino acids in D. aromatica) with multiple transmembrane segments and characteristic P-type ATPase domains including phosphorylation and ATP-binding sites , the KdpC protein is typically smaller and contains fewer transmembrane segments. The KdpC protein likely interacts closely with both KdpA and KdpB to stabilize the complex and regulate its activity. Unlike KdpB, which contains the catalytic core with the characteristic amino acid sequence for ATP hydrolysis, KdpC likely does not possess intrinsic enzymatic activity but functions as a regulatory subunit through protein-protein interactions.

What expression systems are most effective for producing recombinant D. aromatica kdpC protein?

Based on successful approaches with other D. aromatica proteins, E. coli expression systems are recommended for recombinant kdpC production . For optimal expression, consider using E. coli strains specifically designed for membrane protein expression (such as C41/C43(DE3) or Lemo21(DE3)) since kdpC is likely a membrane-associated protein. Expression vectors containing strong inducible promoters (T7, tac) with N-terminal or C-terminal His-tags facilitate purification while maintaining protein functionality. Temperature optimization is critical—expression at lower temperatures (16-20°C) after induction often yields better results for membrane proteins than standard 37°C protocols, reducing inclusion body formation and improving proper folding.

What purification strategy yields the highest purity and activity for recombinant kdpC protein?

A multi-step purification approach is recommended for recombinant kdpC. Begin with immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged proteins . For membrane-associated proteins like kdpC, solubilization with mild detergents (such as n-dodecyl β-D-maltoside or CHAPS) is crucial before purification. Follow IMAC with size-exclusion chromatography to separate aggregates and obtain homogeneous protein preparations. Aim for purity greater than 90% as determined by SDS-PAGE . Throughout purification, maintain a stable buffer environment (typically PBS-based with slight modifications) and consider adding stabilizing agents such as glycerol (5-10%) to maintain protein activity. For functional studies, it's essential to verify that the purified protein retains its native conformation using circular dichroism or thermal shift assays.

How can researchers assess the functionality of purified recombinant kdpC?

To assess recombinant kdpC functionality, several complementary approaches are recommended:

Assessment MethodPrincipleExpected ResultsLimitations
ATP hydrolysis assayMeasures ATPase activity of reconstituted Kdp complexIncreased ATP hydrolysis in presence of K⁺Requires functional complex assembly
Binding assaysMeasures interaction with KdpA/KdpBKD values in nanomolar rangeMay not reflect in vivo function
K⁺ transport assaysMeasures K⁺ uptake in proteoliposomesK⁺ uptake dependent on ATP hydrolysisTechnical complexity
Complementation assaysTests function in kdpC-deficient strainsRestoration of growth in low-K⁺ mediaRequires genetic system

For all functional assays, it's critical to include appropriate positive and negative controls and to carefully control experimental conditions including temperature, pH, and ionic strength, which can significantly impact the activity of membrane transport proteins.

What techniques are most informative for analyzing kdpC protein structure?

For comprehensive structural analysis of kdpC, a multi-technique approach is recommended:

  • X-ray crystallography provides high-resolution structural information but requires well-diffracting crystals. For membrane proteins like kdpC, lipidic cubic phase crystallization may be more successful than traditional vapor diffusion methods.

  • Cryo-electron microscopy (cryo-EM) is particularly valuable for membrane protein complexes and can reveal the structural relationship between kdpC and other Kdp subunits without crystallization.

  • Nuclear magnetic resonance (NMR) spectroscopy can provide information about protein dynamics and ligand binding, though size limitations may necessitate focused studies on specific domains.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions involved in protein-protein interactions and conformational changes without requiring crystallization.

  • Molecular dynamics simulations can complement experimental data by predicting protein behavior in membrane environments and during conformational changes.

The choice of technique should be guided by specific research questions, available resources, and the properties of the recombinant protein preparation.

How does the protein secretion pathway for kdpC compare with other membrane proteins in D. aromatica?

Based on patterns observed in other D. aromatica proteins, kdpC likely utilizes one of two major secretion pathways to reach its final cellular location. Unlike the atypical NosZ protein which possesses a Sec-type signal peptide for translocation across the cytoplasmic membrane , membrane proteins in the KdpABC complex may employ different mechanisms. Analysis of signal sequences can determine whether kdpC uses the Sec pathway (characterized by hydrophobic signal sequences) or the Tat pathway (twin-arginine translocation, characterized by the [RRx(F|L)] motif) . Understanding the secretion pathway has important implications for recombinant expression strategies, as proper targeting is essential for functional studies. When expressing recombinant kdpC, preserving the native signal sequence or replacing it with a compatible one for the expression host is critical for proper protein localization.

What is known about the conservation of functional residues in kdpC across different bacterial species?

While specific information about kdpC conservation isn't available in the search results, we can extrapolate from patterns observed in related proteins. Similar to how NosZ proteins show conservation in copper-binding motifs , kdpC likely contains conserved residues at protein-protein interaction interfaces where it contacts kdpB and kdpA. Comparative sequence analysis across bacterial species would reveal these conserved regions, which often correspond to functionally important sites. Multiple sequence alignment tools like Clustal Omega can identify highly conserved residues across diverse bacterial species. Conservation analysis should focus particularly on residues at protein interfaces and potential regulatory sites. Experimental validation of these predicted functional residues can be performed using site-directed mutagenesis followed by functional assays to determine their impact on potassium transport and ATPase activity.

How should researchers design experiments to study the regulatory function of kdpC in the potassium transport system?

When designing experiments to study kdpC regulatory function, researchers should follow these methodological steps:

  • Start by clearly defining the independent variable (e.g., kdpC concentration, mutation status, or environmental conditions) and dependent variable (e.g., ATPase activity, potassium transport rate) .

  • Develop a specific, testable hypothesis about how kdpC affects the function of the Kdp complex.

  • Design experimental treatments that systematically manipulate the independent variable, such as:

    • Reconstitution studies with varying ratios of kdpC to other Kdp subunits

    • Site-directed mutagenesis of predicted regulatory residues

    • Varying potassium concentrations or osmotic conditions

  • Include appropriate controls, particularly:

    • Positive controls (fully functional Kdp complex)

    • Negative controls (Kdp complex lacking kdpC)

    • System controls (non-functional mutants of other subunits)

  • Plan measurements of your dependent variable using complementary methods to increase validity:

    • Direct assessment of potassium transport (e.g., radioactive ⁸⁶Rb⁺ uptake assays)

    • ATP hydrolysis measurements (e.g., coupled enzyme assays)

    • Binding affinity studies (e.g., isothermal titration calorimetry)

Control extraneous variables by standardizing protein purification methods, buffer compositions, and assay conditions across experimental treatments .

What are the key considerations when designing experiments to compare wild-type and mutant kdpC proteins?

When comparing wild-type and mutant kdpC proteins, researchers should implement these critical design elements:

  • Mutation selection should be hypothesis-driven, targeting:

    • Conserved residues identified through sequence alignment

    • Predicted protein-protein interaction interfaces

    • Potential regulatory sites (phosphorylation, ligand binding)

  • Implement rigorous controls to ensure valid comparisons:

    • Express and purify wild-type and mutant proteins in parallel using identical conditions

    • Verify protein folding and stability using circular dichroism or thermal shift assays

    • Confirm equivalent expression levels and purity by SDS-PAGE and Western blotting

  • Use a within-subjects design where possible, testing wild-type and mutant proteins in the same experimental system rather than across different preparations .

  • Apply multiple complementary assays to assess function:

    • In vitro reconstitution with other Kdp subunits

    • ATPase activity measurements

    • Potassium transport assays in proteoliposomes

    • Binding affinity measurements with interacting partners

  • Analyze structure-function relationships using:

    • Structural modeling to predict effects of mutations

    • Conformational analysis by limited proteolysis or HDX-MS

    • Interaction studies using techniques like surface plasmon resonance

Document all experimental conditions thoroughly to enable reproducibility, including buffer compositions, protein concentrations, temperature, and assay duration.

How can researchers effectively study the interaction between kdpC and other components of the Kdp system?

To effectively study kdpC interactions with other Kdp components, implement these methodological approaches:

  • In vitro binding assays:

    • Pull-down assays using differentially tagged proteins

    • Surface plasmon resonance to determine binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for interactions in solution

  • Structural studies of the complex:

    • Cryo-EM of the assembled complex

    • Chemical cross-linking combined with mass spectrometry

    • FRET-based assays to measure distances between components

  • Functional reconstitution studies:

    • Systematic assembly of the complex with variant components

    • Activity assays to correlate composition with function

    • Liposome reconstitution to assess transport in a membrane environment

  • In vivo interaction studies:

    • Bacterial two-hybrid systems

    • Förster resonance energy transfer (FRET) in living cells

    • Bimolecular fluorescence complementation

  • Computational approaches:

    • Molecular docking simulations

    • Molecular dynamics to predict stable interaction interfaces

    • Evolutionary coupling analysis to identify co-evolving residues

What are the optimal storage conditions for maintaining recombinant kdpC stability and activity?

Based on established protocols for similar recombinant proteins from D. aromatica, the following storage recommendations should be implemented for kdpC:

For lyophilized protein:

  • Store at -20°C for long-term stability

  • The lyophilized form may remain stable at room temperature for up to 3 weeks if needed for shipping or temporary storage

  • Protect from humidity by storing with desiccant

For reconstituted protein:

  • Short-term storage (2-7 days): 4°C in appropriate buffer

  • Medium-term storage (up to 3 months): -20°C in small aliquots

  • Long-term storage: -80°C with 50% glycerol as cryoprotectant

To minimize activity loss:

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

  • Store working aliquots at 4°C for up to one week

  • Consider adding stabilizing agents such as trehalose (6%) to storage buffer

  • Maintain pH stability with Tris/PBS-based buffer systems (pH 7.4-8.0)

For handling during experiments:

  • Always centrifuge tubes before opening to collect condensation

  • Avoid vigorous vortexing or pipetting that may denature the protein

  • Maintain minimum concentration of 100 μg/ml when reconstituting to prevent protein aggregation

What reconstitution protocols maximize the recovery of functional kdpC protein?

For optimal reconstitution of lyophilized kdpC protein:

  • Preparation steps:

    • Allow the vial to equilibrate to room temperature before opening

    • Briefly centrifuge to ensure all material is at the bottom of the vial

    • Prepare all buffers fresh and filter through 0.2 μm filters

  • Reconstitution procedure:

    • Use deionized sterile water or appropriate buffer for initial reconstitution

    • Aim for a final concentration of 0.1-1.0 mg/mL for optimal stability

    • Add reconstitution solution gently down the side of the vial

    • Allow protein to dissolve with gentle swirling rather than vortexing

    • For membrane proteins like kdpC, consider adding mild detergents if needed for solubility

  • Post-reconstitution steps:

    • Add glycerol to 5-50% final concentration for cryoprotection

    • Prepare small single-use aliquots to avoid freeze-thaw cycles

    • Verify protein concentration using Bradford or BCA assay

    • Confirm protein integrity via SDS-PAGE before proceeding to functional assays

  • For functional studies:

    • If detergent was used, consider detergent removal for certain applications

    • For membrane reconstitution, prepare proteoliposomes using gentle methods

    • Verify proper folding using circular dichroism or fluorescence spectroscopy

How can researchers troubleshoot issues with protein instability during experimental procedures?

When encountering stability issues with recombinant kdpC, implement this systematic troubleshooting approach:

  • Diagnose the problem type:

    • Precipitation/aggregation (visible particles, turbidity)

    • Activity loss without visible aggregation

    • Proteolytic degradation (lower molecular weight bands on SDS-PAGE)

  • Buffer optimization strategies:

    • Test pH range (typically 7.0-8.0) to identify optimal stability

    • Evaluate different buffer systems (Tris, HEPES, phosphate)

    • Screen salt concentrations to optimize ionic strength

    • Add stabilizing agents incrementally:

      • Glycerol (5-20%)

      • Trehalose (5-10%)

      • Non-ionic detergents (if appropriate)

      • Reducing agents (DTT, β-mercaptoethanol) if disulfide formation is an issue

  • Temperature management:

    • Maintain samples on ice during experimental procedures

    • Determine temperature sensitivity profile to identify safe working range

    • Consider room temperature stability for specific applications

  • Prevent proteolytic degradation:

    • Add protease inhibitor cocktail to all buffers

    • Minimize sample handling time

    • Consider filtration or centrifugation steps to remove potential proteases

  • For membrane protein-specific issues:

    • Optimize detergent type and concentration

    • Consider lipid addition to stabilize native conformation

    • Test protein-stabilizing compounds like scFv fragments or nanobodies

For each troubleshooting intervention, implement controlled experiments comparing before/after stability and activity to identify the most effective solution.

What statistical approaches are most appropriate for analyzing data from kdpC functional studies?

For robust statistical analysis of kdpC functional studies, implement these approaches based on experimental design:

  • For comparing wild-type vs. mutant activity:

    • Paired t-tests for direct comparisons with normally distributed data

    • Mann-Whitney U test for non-parametric data

    • ANOVA followed by post-hoc tests (e.g., Tukey) when comparing multiple variants

  • For dose-response relationships:

    • Nonlinear regression to fit appropriate models (e.g., Hill equation)

    • Calculate and compare EC50/IC50 values with 95% confidence intervals

    • Analysis of residuals to validate model fit

  • For kinetic studies:

    • Fit to appropriate enzymatic models (Michaelis-Menten, allosteric)

    • Bootstrap analysis to generate confidence intervals for kinetic parameters

    • Global fitting approaches for complex mechanisms

  • For interaction studies:

    • Scatchard or Hill plot analysis for binding data

    • Statistical comparison of association/dissociation constants

    • Analysis of cooperativity using appropriate mathematical models

  • Data quality assessment:

    • Implement outlier detection using standardized methods (Grubbs test)

    • Report effect sizes along with p-values

    • Calculate power analysis to ensure adequate sample sizes

Ensure all statistical analyses include appropriate controls, sufficient replication (minimum n=3, preferably higher), and clearly stated statistical significance criteria (typically p<0.05) .

How can researchers address data inconsistencies when comparing kdpC function across different experimental conditions?

When confronting data inconsistencies in kdpC functional studies, apply this systematic approach:

  • Source identification:

    • Examine protein batch variation through quality control metrics

    • Evaluate assay reproducibility with technical replicates

    • Assess environmental factors (temperature, pH, buffer composition)

    • Consider instrument calibration and drift

  • Analytical strategies:

    • Normalize data using internal standards or reference conditions

    • Apply multiple data normalization approaches and compare outcomes

    • Implement mixed-effects statistical models that account for batch variation

    • Use Bland-Altman plots to visualize systemic differences between methods

  • Experimental design improvements:

    • Include standard samples across all experimental runs

    • Implement randomized testing order to distribute random error

    • Blind analysis to prevent unconscious bias

    • Increase replication for conditions showing high variability

  • Data integration approaches:

    • Apply meta-analysis techniques to combine data across experiments

    • Use weighting factors based on data quality metrics

    • Develop multivariate models incorporating potential confounding variables

    • Consider Bayesian approaches to account for prior knowledge and uncertainty

  • Reporting recommendations:

    • Transparently document all inconsistencies and analytical decisions

    • Present raw data alongside normalized data

    • Report confidence intervals rather than just point estimates

    • Discuss biological vs. technical sources of variation

What are the best approaches for integrating structural and functional data to understand kdpC mechanism?

To effectively integrate structural and functional data for mechanistic insights into kdpC:

  • Structure-function correlation methods:

    • Map functional data (from mutagenesis) onto structural models

    • Calculate conservation scores for surface residues and relate to function

    • Analyze electrostatic surface properties in relation to binding partners

    • Identify potential allosteric networks using normal mode analysis

  • Integrative computational approaches:

    • Molecular dynamics simulations informed by experimental constraints

    • Brownian dynamics to model transient interactions

    • Machine learning approaches to identify patterns across datasets

    • Network analysis to identify cooperative interactions between residues

  • Combined experimental strategies:

    • HDX-MS studies under different functional states (with/without ATP, K⁺)

    • Site-directed spin labeling combined with EPR to track conformational changes

    • FRET studies to measure distances between specific residues during function

    • Time-resolved studies to capture transitional states

  • Data visualization techniques:

    • Create interactive structural models color-coded by functional parameters

    • Develop motion pathway models based on structural and functional constraints

    • Generate structure-based pharmacophore models for regulatory site identification

    • Produce state transition diagrams integrating all available data

  • Validation approaches:

    • Design and test predictions from integrated models

    • Cross-validate findings using orthogonal experimental techniques

    • Perform evolutionary analysis to support mechanistic hypotheses

    • Compare with related proteins to identify conserved mechanistic features

The most successful integrative approaches iterate between computational prediction and experimental validation, gradually refining mechanistic models.

How can researchers leverage kdpC studies to understand bacterial adaptation to potassium limitation?

To investigate bacterial adaptation to potassium limitation through kdpC research:

  • Design experimental evolution studies:

    • Subject D. aromatica to progressively lower K⁺ concentrations

    • Sequence evolved strains to identify mutations in kdpC and related genes

    • Perform competitive fitness assays between ancestral and evolved strains

    • Use transcriptomics to identify regulatory changes affecting kdpC expression

  • Comparative genomics approaches:

    • Analyze kdpC sequences from bacteria inhabiting K⁺-limited environments

    • Identify signature adaptations through positive selection analysis

    • Compare regulatory elements controlling kdpC expression across species

    • Correlate kdpC sequence variations with environmental K⁺ availability

  • Functional characterization methods:

    • Develop reporter systems to monitor kdpC expression under K⁺ limitation

    • Create chimeric proteins with kdpC domains from different species

    • Measure potassium affinity changes in evolved strains

    • Assess cross-talk between potassium and other stress response systems

  • Structural biology investigations:

    • Determine kdpC structures under different potassium concentrations

    • Identify conformational changes associated with adaptation

    • Map adaptive mutations onto structural models

    • Investigate protein dynamics using computational approaches

  • Systems biology integration:

    • Model metabolic adjustments during K⁺ limitation

    • Identify regulatory networks controlling kdpC expression

    • Measure energy allocation changes during adaptation

    • Develop predictive models of bacterial survival under K⁺ stress

What approaches can be used to study the potential role of kdpC in D. aromatica's unique metabolic capabilities?

To investigate kdpC's role in D. aromatica's distinctive metabolism:

  • Genetic manipulation strategies:

    • Develop knockout/knockdown systems for kdpC

    • Create conditional expression systems to control kdpC levels

    • Introduce point mutations to alter specific functions

    • Assess phenotypic changes in aromatic compound metabolism

  • Physiological characterization:

    • Measure growth rates on different aromatic substrates under varying K⁺ conditions

    • Assess benzene oxidation capacity with altered kdpC function

    • Determine the effect of kdpC mutations on chlorate or nitrate reduction

    • Monitor intracellular K⁺ levels during different metabolic states

  • Omics-based approaches:

    • Perform transcriptomics to identify co-regulated genes

    • Use proteomics to detect protein-protein interaction networks

    • Employ metabolomics to identify altered metabolic intermediates

    • Conduct fluxomics to quantify changes in metabolic pathway activity

  • Biochemical investigations:

    • Assess energy coupling between K⁺ transport and aromatic metabolism

    • Measure enzyme activities of key metabolic enzymes with varying K⁺ levels

    • Investigate protein-protein interactions between kdpC and metabolic enzymes

    • Determine the effect of K⁺ concentration on dioxygenase activity

  • Ecological studies:

    • Compare K⁺ requirements for different metabolic activities across environments

    • Assess competitive fitness with altered kdpC in mixed communities

    • Investigate kdpC expression during benzene degradation in field conditions

    • Determine if potassium limitation affects preference for electron acceptors

How might understanding kdpC contribute to biotechnological applications involving D. aromatica?

The study of kdpC can inform several biotechnological applications:

  • Bioremediation optimization:

    • Engineer improved D. aromatica strains with enhanced K⁺ uptake efficiency

    • Develop optimal nutrient formulations for benzene bioremediation sites

    • Create biosensors using kdpC regulatory elements to monitor K⁺ availability

    • Design co-cultures with complementary nutrient requirements for enhanced degradation

  • Protein engineering applications:

    • Design modified kdpC with altered regulatory properties

    • Develop chimeric transport systems with enhanced substrate specificity

    • Create biosensors using engineered kdpC proteins

    • Optimize expression systems for membrane protein production

  • Metabolic engineering strategies:

    • Manipulate K⁺ homeostasis to enhance desired metabolic pathways

    • Develop strains with optimized energy allocation between transport and metabolism

    • Engineer feedback regulation between K⁺ sensing and aromatic degradation pathways

    • Create synthetic regulatory circuits incorporating kdpC control elements

  • Bioprocess development:

    • Optimize biofilm formation for immobilized bioreactor systems

    • Develop fed-batch strategies that maintain optimal K⁺ levels

    • Design bioreactor systems with controlled ion gradients

    • Create monitoring systems based on kdpC activity

  • Comparative systems analysis:

    • Apply knowledge from D. aromatica to other bioremediation-relevant organisms

    • Identify conserved principles of ion transport regulation across species

    • Develop predictive models for bacterial performance under varying conditions

    • Create databases of structure-function relationships for biotechnological applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.