Recombinant Dechloromonas aromatica Probable intracellular septation protein A (Daro_2903)

What is Daro_2903 and what is its putative function in Dechloromonas aromatica?

Daro_2903 is classified as a probable intracellular septation protein A in Dechloromonas aromatica, also known as inner membrane-spanning protein YciB. Based on its classification, it likely plays a role in cell division processes, particularly in septum formation. The protein consists of 202 amino acids and appears to contain transmembrane domains as suggested by its highly hydrophobic amino acid sequence with multiple predicted membrane-spanning regions . As an inner membrane protein, it likely contributes to the cellular architecture that supports D. aromatica's specialized metabolic capabilities, including denitrification and aromatic compound degradation.

What are the structural characteristics of the Daro_2903 protein?

The Daro_2903 protein is 202 amino acids in length with a sequence rich in hydrophobic residues, consistent with its predicted function as a membrane protein. Its amino acid sequence (MKLLFDLFPVILFFATFKYAEKSPELAASWMGSLLGFVPDDIKLAPILLATVVVIAATVA QIIWVHFRHGKVDKMLWVSLVLVVVFGGLTLAFQNEAFIKWKPTILYWVFAGSMIFSAFI LKKNPIKAMLGEQLTLPEPVWGKVNLSWIGFFLFMGALNLFVAFNFPTDTWVNFKLFGGM GLMLVFVLGQGMLLSKYVEEEK) suggests multiple transmembrane domains . While detailed structural studies specifically on Daro_2903 appear limited in the available literature, homology modeling based on related septation proteins would likely reveal a structure with multiple membrane-spanning alpha-helical regions typical of inner membrane proteins involved in septation processes.

How is recombinant Daro_2903 typically expressed and purified for research purposes?

Recombinant Daro_2903 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The expression system utilizes the full-length protein sequence (amino acids 1-202). After expression, the protein is purified through affinity chromatography using the His-tag, achieving greater than 90% purity as determined by SDS-PAGE . The purified protein is subsequently lyophilized for storage stability. For reconstitution, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

What are the optimal conditions for reconstituting lyophilized Daro_2903 protein for functional studies?

For optimal reconstitution of lyophilized Daro_2903, the recommended protocol includes briefly centrifuging the vial before opening to bring contents to the bottom, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage stability, addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard default concentration . The reconstituted protein should be stored at -20°C/-80°C, with aliquoting strongly advised to avoid repeated freeze-thaw cycles which can compromise protein integrity. Working aliquots may be stored at 4°C for up to one week . For functional studies, buffer composition may need to be optimized depending on the specific assay, but a Tris/PBS-based buffer at pH 8.0 is typically used as the storage buffer .

How can researchers effectively analyze the membrane integration of Daro_2903 in experimental systems?

To analyze membrane integration of Daro_2903, researchers should employ a multi-faceted approach:

• Membrane fractionation: Separate inner and outer membrane fractions using sucrose gradient ultracentrifugation, followed by western blotting with anti-His antibodies to detect the recombinant protein.

• Protease protection assays: Treat intact cells or spheroplasts with proteases like trypsin to determine which portions of the protein are accessible, providing insights into membrane topology.

• Fluorescence microscopy: Create GFP fusion constructs to visualize localization patterns, particularly during different growth phases and cell division.

• Crosslinking studies: Use membrane-impermeable crosslinking agents to identify protein-protein interactions at the membrane interface.

• Liposome reconstitution: Incorporate purified Daro_2903 into artificial liposomes to study its intrinsic properties in a controlled membrane environment.

When analyzing results, researchers should consider the highly hydrophobic nature of the protein and the possibility that detergents used in membrane protein studies might affect its structural integrity.

What strategies can be employed to study the role of Daro_2903 in cell division and septum formation?

To investigate the role of Daro_2903 in cell division and septum formation, researchers should consider these methodological approaches:

• Gene knockout/knockdown studies: Create deletion mutants or use CRISPR interference to downregulate Daro_2903 expression, followed by microscopic analysis of cell morphology, septum formation, and division rates.

• Time-lapse microscopy: Employ fluorescent markers for the septum (such as FtsZ-GFP) together with Daro_2903 tagged with a different fluorophore to track co-localization during the cell cycle.

• Protein-protein interaction studies: Use bacterial two-hybrid systems, co-immunoprecipitation, or proximity labeling methods to identify interaction partners within the divisome complex.

• Complementation assays: Express Daro_2903 in related bacteria with mutations in homologous septation genes to assess functional conservation.

• Site-directed mutagenesis: Introduce mutations in conserved residues to identify functionally critical regions of the protein.

The experimental design should account for the environmental conditions that D. aromatica typically experiences, including varying pH and salinity levels, as these factors are known to significantly affect the bacterium's physiology .

How might Daro_2903 function relate to the denitrification capabilities of Dechloromonas aromatica under stress conditions?

While direct evidence linking Daro_2903 to denitrification is not explicitly provided in the available literature, several hypothetical connections merit investigation:

The function of membrane proteins like Daro_2903 may be critical for maintaining cellular homeostasis under stress conditions. D. aromatica demonstrates altered denitrification kinetics under salt and alkaline stress conditions, with significant changes in N₂O production and consumption . As an inner membrane protein potentially involved in septation, Daro_2903 might influence:

• Membrane integrity: Salt and pH stresses (0.7% NaCl or pH 8.0) severely impact D. aromatica's growth and denitrification enzyme function . Proper septation and membrane organization likely play crucial roles in maintaining the protein complexes required for denitrification.

• Enzyme localization: Denitrification enzymes including nitrite reductase (encoded by nirS genes) and nitrous oxide reductase (encoded by nosZ) must be properly positioned within the cell membrane and periplasm. Changes in the nosZ/(nirS1+nirS2) transcription ratios correlate with N₂O production or consumption patterns .

• Stress response integration: Under stress conditions, coordination between cell division (involving septation proteins) and metabolic activities (including denitrification) becomes critical for survival.

Research investigating correlations between Daro_2903 expression/activity and denitrification kinetics under varying environmental conditions could reveal important functional relationships.

What techniques can be used to investigate potential post-translational modifications of Daro_2903 and their impact on function?

To investigate post-translational modifications (PTMs) of Daro_2903 and their functional significance, researchers should consider this methodological framework:

• Mass spectrometry-based approaches:

  • Employ high-resolution LC-MS/MS after enrichment techniques specific for different PTMs (phosphorylation, glycosylation, etc.)

  • Use multiple proteolytic enzymes to maximize sequence coverage, especially important for membrane proteins

  • Consider top-down proteomics to analyze the intact protein and maintain PTM context

• Site-directed mutagenesis:

  • Mutate predicted modification sites (e.g., change potential phosphorylation sites from Ser/Thr to Ala)

  • Assess functional consequences through complementation assays in knockout strains

• Conditional PTM analysis:

  • Compare PTM profiles under different environmental conditions known to affect D. aromatica physiology (varied pH, salinity, oxygen tension)

  • Correlate changes in PTM patterns with alterations in denitrification activity

• PTM-specific antibodies:

  • Develop antibodies that specifically recognize modified forms of Daro_2903

  • Use for western blotting and immunofluorescence microscopy to track modification states

The analysis should focus particularly on conditions that affect denitrification efficiency, such as the salt stress (0.7% NaCl) and alkaline stress (pH 8.0) conditions where significant changes in growth and N₂O production have been observed .

How does the expression profile of Daro_2903 correlate with cellular responses to environmental stressors in Dechloromonas aromatica?

To investigate the correlation between Daro_2903 expression and cellular responses to environmental stressors, researchers should implement a comprehensive approach:

• Quantitative transcriptomics and proteomics:

  • Perform RNA-Seq and quantitative proteomics to measure Daro_2903 expression levels under varied conditions

  • Compare expression profiles under control conditions (pH 7.0, 0.05% NaCl) versus stress conditions (pH 8.0, 0.7% NaCl)

  • Analyze co-expression patterns with known stress response genes and denitrification pathway components

• Temporal expression analysis:

  • Monitor expression dynamics throughout growth phases, particularly during the extended lag phase observed under salt stress (>118 hours)

  • Correlate with temporal patterns of N₂O production and consumption

• Promoter analysis:

  • Identify regulatory elements in the Daro_2903 promoter region

  • Use reporter gene fusions to validate responses to specific stressors

• Comparative analysis with denitrification genes:

  • Correlate Daro_2903 expression with the transcriptional patterns of nirS1, nirS2, and nosZ genes

  • Examine whether the nosZ/(nirS1+nirS2) ratio correlates with Daro_2903 expression

This approach would help determine whether Daro_2903 expression patterns align with the substantial physiological changes observed in D. aromatica under stress conditions, including altered growth rates (reduced from 0.218 h⁻¹ to 0.032 h⁻¹ under salt stress) and increased N₂O accumulation .

How conserved is the Daro_2903 protein across bacterial species, and what does this suggest about its evolutionary importance?

To assess the evolutionary conservation of Daro_2903, researchers should perform:

• Comprehensive sequence homology analysis:

  • Conduct BLAST searches against diverse bacterial genomes

  • Perform multiple sequence alignments to identify conserved domains and residues

  • Generate phylogenetic trees to visualize evolutionary relationships

• Functional domain analysis:

  • Identify conserved functional motifs that may indicate critical activities

  • Compare with characterized septation proteins from model organisms

• Genomic context analysis:

  • Examine the organization of genes surrounding Daro_2903 in D. aromatica

  • Compare with synteny in related organisms to identify conserved gene clusters

• Structure prediction and comparison:

  • Use homology modeling to predict the structure of Daro_2903

  • Compare structural features with characterized septation proteins

What can comparative studies between Daro_2903 and homologous proteins in other denitrifying bacteria reveal about functional specialization?

Comparative studies between Daro_2903 and homologs in other denitrifying bacteria can reveal important insights through:

• Functional complementation experiments:

  • Express Daro_2903 in other denitrifiers with mutations in homologous genes

  • Test whether complementation efficiency correlates with denitrification capacity

• Correlation with denitrification efficiency:

  • Compare sequence variations between Daro_2903 homologs from different denitrifiers

  • Correlate sequence differences with variations in denitrification kinetics (particularly N₂O production/consumption ratios)

• Co-evolution analysis:

  • Investigate whether Daro_2903 evolution correlates with evolution of denitrification genes

  • Examine whether bacteria that exhibit minimal N₂O accumulation (like Dechloromonas spp. ) show distinct patterns in their septation protein sequences

• Environmental adaptation signatures:

  • Analyze whether Daro_2903 variants from bacteria adapted to different environments (varying salinity, pH, etc.) show specific sequence adaptations

  • Correlate with the differential responses to stress conditions observed across denitrifying species

Such comparative approaches could reveal whether specialized features of Daro_2903 might contribute to the distinctive denitrification characteristics of D. aromatica, such as its normally efficient N₂O consumption that becomes compromised under stress conditions .

What are the common challenges in working with recombinant membrane proteins like Daro_2903 and how can they be addressed?

Working with recombinant membrane proteins presents several challenges that researchers should anticipate and address:

• Expression challenges:

  • Problem: Toxicity to host cells and low expression yields

  • Solution: Optimize expression using specialized strains (C41/C43), tight regulation of expression, and lower induction temperatures (16-20°C)

• Solubilization difficulties:

  • Problem: Inefficient extraction from membranes

  • Solution: Screen multiple detergents (DDM, LDAO, etc.) at various concentrations; consider native nanodiscs or styrene maleic acid lipid particles (SMALPs) for extraction in native lipid environment

• Protein stability issues:

  • Problem: Recombinant Daro_2903 may be unstable outside the membrane environment

  • Solution: Include stabilizing agents (glycerol, specific lipids) in buffers; maintain cold chain throughout purification; consider adding specific ligands if known

• Functional reconstitution:

  • Problem: Difficulty confirming proper folding and function

  • Solution: Develop activity assays; use circular dichroism to assess secondary structure; confirm membrane incorporation through liposome flotation assays

• Storage considerations:

  • Problem: Protein degradation during storage

  • Solution: As recommended for Daro_2903, store with glycerol (5-50%) at -20°C/-80°C, avoid repeated freeze-thaw cycles, and consider flash-freezing small aliquots in liquid nitrogen

For Daro_2903 specifically, researchers should pay particular attention to the buffer pH, maintaining it at the recommended pH 8.0 , especially given the known sensitivity of D. aromatica to pH conditions .

How can researchers validate that recombinant Daro_2903 maintains its native conformation and functionality after purification?

To validate that recombinant Daro_2903 maintains its native conformation and functionality after purification, researchers should employ multiple complementary approaches:

• Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

  • Tryptophan fluorescence to assess tertiary structure

  • Size exclusion chromatography to verify monodispersity and appropriate oligomeric state

• Membrane incorporation verification:

  • Liposome reconstitution followed by flotation assays

  • Proteoliposome freeze-fracture electron microscopy

  • Fluorescence energy transfer experiments to confirm proper orientation

• Functional validation:

  • In vitro protein-protein interaction assays with known divisome components

  • Complementation of appropriate bacterial mutants

  • Microscopy-based localization studies in relevant cellular contexts

• Comparative analysis:

  • Parallel characterization of the protein isolated from native membranes (where feasible)

  • Comparison of key properties between recombinant and native forms

When interpreting results, researchers should consider that true validation of septation protein function ultimately requires cellular assays, as the complex process of bacterial cell division involves numerous coordinated interactions that are difficult to recapitulate in vitro.

What emerging technologies could advance our understanding of Daro_2903's role in Dechloromonas aromatica physiology?

Several cutting-edge technologies hold promise for elucidating Daro_2903's role:

• Cryo-electron microscopy (Cryo-EM):

  • Enables visualization of membrane protein structure at near-atomic resolution

  • Could reveal how Daro_2903 integrates into the membrane and potentially interacts with divisome components

• Super-resolution microscopy:

  • Techniques like PALM, STORM, or STED could track Daro_2903 localization during cell division with nanometer precision

  • Dual-color imaging could reveal temporal relationships with other division proteins

• Single-molecule tracking:

  • Following individual Daro_2903 molecules in living cells to understand dynamics

  • Correlating movement patterns with specific stages of denitrification or stress response

• Proximity-dependent labeling:

  • BioID or APEX2 fusion proteins could identify proximal interaction partners in the native cellular environment

  • Particularly valuable for mapping the membrane protein interactome

• Microfluidics combined with live-cell imaging:

  • Creating controlled microenvironments to precisely manipulate stress conditions

  • Real-time observation of Daro_2903 behavior under defined salt or pH stress conditions that affect denitrification

• CRISPR interference with inducible promoters:

  • Precise temporal control of Daro_2903 expression

  • Observation of immediate cellular responses to protein depletion

These technologies could help establish connections between Daro_2903 function and the distinctive denitrification characteristics of D. aromatica, particularly its unusual sensitivity to environmental stressors that alter N₂O production/consumption balance .

How might understanding Daro_2903 contribute to broader knowledge about bacterial adaptation to environmental stressors?

Understanding Daro_2903 could significantly contribute to knowledge about bacterial stress adaptation through several avenues:

• Membrane integrity and stress response:

  • If Daro_2903 is involved in maintaining membrane integrity during division, its role may be critical during environmental stress

  • The significant growth inhibition observed in D. aromatica under salt (0.7% NaCl) and alkaline (pH 8.0) stress may partially reflect compromised septation processes

• Coordination of division and metabolism:

  • Insights into how bacteria coordinate cell division (involving Daro_2903) with metabolic activities under stress

  • Particularly relevant to understanding how denitrification enzyme expression and activity remain coordinated with growth under challenging conditions

• Biogeochemical cycle implications:

  • Understanding cellular mechanisms that influence denitrification kinetics and N₂O emissions

  • The substantial N₂O accumulation observed under stress conditions (up to 18.7% of reduced NO₃⁻ recovered as N₂O at pH 8.0) has significant environmental implications

• Evolution of stress tolerance mechanisms:

  • Comparative studies of Daro_2903 across bacteria with different stress tolerances could reveal adaptation mechanisms

  • Potential applications in engineering bacterial strains with enhanced environmental resilience

• Biotechnological applications:

  • Insights could inform strategies to optimize denitrification processes in wastewater treatment

  • Potential applications in engineering bacterial strains with controlled N₂O emissions