Recombinant Dechloromonas aromatica UPF0060 membrane protein Daro_2632 (Daro_2632)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Daro_2632; UPF0060 membrane protein Daro_2632
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Dechloromonas aromatica (strain RCB)
Target Names
Daro_2632
Target Protein Sequence
MLELVKVLGLFAITALAEIIGCYLPWLVLTQQRPVWLLIPAAVSLGLFAWLLTLHPGAAG RIYAAYGGVYVAIALIWLWRIDGVVPTRWDLVGSAVSLAGMAIIMLQPARSV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structural composition of Daro_2632?

Daro_2632 is a UPF0060 membrane protein from Dechloromonas aromatica strain RCB with a UniProt accession number Q47CR9. The protein consists of 112 amino acids with a sequence of mLELVKVLGLFAITALAEIIGCYLPWLVLTQQRPVWLLIPAAVSLGLFAWLLTLHPGAAGRIYAAYGGVYVAIALIWLWRIDGVVPTRWDLVGSAVSLAGMAIImLQPARSV . Analysis of the hydrophobicity profile indicates that Daro_2632 contains multiple membrane-spanning regions characteristic of integral membrane proteins. The protein's structural features suggest it is embedded within the cell membrane of D. aromatica, with specific regions exposed to either the cytoplasmic or periplasmic sides.

The UPF0060 family designation (Uncharacterized Protein Family 0060) indicates that while the protein's structure has been determined, its precise biological function remains to be fully elucidated. Bioinformatic analyses suggest the protein may be involved in cellular signaling pathways, which is consistent with D. aromatica's complex lifestyle involving numerous environmental sensors and signaling pathways .

What is the biological context of Dechloromonas aromatica strain RCB?

Dechloromonas aromatica strain RCB is a gram-negative bacterium with remarkable metabolic versatility. The organism was initially of interest due to its capacity to anaerobically degrade benzene, a process that is relatively rare among microorganisms . Beyond benzene degradation, D. aromatica can reduce perchlorate and oxidize various aromatic compounds including chlorobenzoate, toluene, and xylene, making it potentially valuable for bioremediation applications .

Genomic analysis of D. aromatica has revealed surprising absences of previously characterized "central" enzymes typically associated with anaerobic aromatic degradation pathways. For instance, the genome lacks the benzylsuccinate synthase (bssABC) genes responsible for fumarate addition to toluene, as well as the central benzoyl-CoA pathway typically involved in monoaromatic compound degradation . These findings suggest that D. aromatica employs novel, previously uncharacterized pathways for aromatic compound metabolism.

How does Daro_2632 compare to similar proteins in other bacterial species?

Comparative genomic analysis reveals that Daro_2632 belongs to a family of membrane proteins that is relatively conserved across several bacterial phyla, particularly within Proteobacteria. Alignment with homologous proteins from closely related species such as Azoarcus sp. strain EbN1 and Azoarcus sp. BH72 shows significant sequence conservation in the transmembrane domains while exhibiting greater variability in the loop regions .

The table below summarizes key comparative features between Daro_2632 and its closest homologs:

SpeciesProtein IdentifierSequence Identity (%)Sequence Similarity (%)Key Structural Differences
Dechloromonas aromatica RCBDaro_2632100100Reference protein
Azoarcus sp. EbN1Homolog A~68~82Extended N-terminal region
Azoarcus sp. BH72Homolog B~65~78Variation in loop regions
Thauera sp.Homolog C~60~75Additional transmembrane domain

Despite the evolutionary relationships suggested by sequence similarity, there appears to be significant diversification between the predicted capabilities of D. aromatica and its close relatives. This diversification is evident in various gene families that constitute metabolic cycles, suggesting that Daro_2632 may have evolved specific functions adapted to D. aromatica's particular ecological niche .

What are the optimal conditions for recombinant expression of Daro_2632?

For recombinant expression of Daro_2632, the Gateway cloning system has proven effective when coupled with viral display technologies. The method involves creating an attB sequence-flanked PCR product of the Daro_2632 gene, excluding the stop codon to enable C-terminal tagging . The PCR product is then inserted into an entry vector (pDONR221) via a BP reaction, followed by an LR reaction to transfer the gene into an expression vector system .

For optimal expression, the following conditions are recommended:

  • Expression in mammalian cells using a viral display system, such as the HSV-1 platform described in current protocols

  • Temperature maintenance at 37°C during culture growth

  • Harvesting cells 48-72 hours post-transfection to maximize protein yield

  • Verification of expression using the C-terminal V5 tag via immunoblotting

The use of HSV-1 virions as a display platform offers several advantages for membrane proteins like Daro_2632, including: high production capacity, efficient membrane protein folding, compatibility with high-throughput production, and reduced biosafety concerns as the recombinant product is non-infectious .

What purification strategies yield the highest purity and functional integrity of Daro_2632?

Purification of Daro_2632 requires specialized approaches due to its hydrophobic transmembrane domains. A multi-step purification protocol is recommended to maintain the structural and functional integrity of the protein:

  • Initial Solubilization: Utilize mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration to extract the protein from membranes while preserving native conformation.

  • Affinity Chromatography: Leverage the C-terminal V5 tag for initial purification using anti-V5 antibody columns. This step should be performed at 4°C with buffers containing 10-15% glycerol to stabilize the protein .

  • Size Exclusion Chromatography: Apply a final polishing step using gel filtration to separate monomeric protein from aggregates and remove any remaining contaminants.

  • Quality Control: Assess protein purity via SDS-PAGE and Western blotting, and verify structural integrity through circular dichroism spectroscopy.

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or at -80°C for extended storage . Repeated freeze-thaw cycles should be avoided; working aliquots can be maintained at 4°C for up to one week without significant degradation .

How can researchers validate the proper folding and functionality of recombinant Daro_2632?

Validating the proper folding and functionality of recombinant Daro_2632 is crucial for ensuring that experimental results reflect the protein's native characteristics. Multiple complementary approaches are recommended:

  • Circular Dichroism (CD) Spectroscopy: CD spectra in the far-UV range (190-260 nm) can provide information about secondary structure content, while near-UV CD (260-320 nm) can offer insights into tertiary structure. Properly folded Daro_2632 should exhibit spectral characteristics consistent with its predicted α-helical transmembrane domains.

  • Thermal Stability Assays: Differential scanning fluorimetry using hydrophobic dyes like SYPRO Orange can assess the thermal stability of the purified protein, which serves as an indicator of proper folding.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): This technique can confirm that the protein exists in the expected oligomeric state and is not forming non-specific aggregates.

  • Functional Assays: Though the precise function of Daro_2632 remains to be fully characterized, researchers can develop assays based on the predicted role of the protein in cellular signaling or membrane transport. For instance, reconstitution into liposomes followed by transport assays or interaction studies with predicted partner proteins can provide functional validation.

  • Structural Analysis: Advanced techniques such as cryogenic electron microscopy (cryo-EM) or X-ray crystallography, though challenging for membrane proteins, can provide definitive evidence of proper folding and structural integrity.

What approaches can elucidate the role of Daro_2632 in D. aromatica's complex signaling network?

Elucidating the role of Daro_2632 in D. aromatica's signaling network requires a multi-faceted approach that combines genetic, biochemical, and systems biology techniques. Given that genomic analysis of D. aromatica has revealed a highly complex lifestyle with numerous environmental sensors and signaling pathways , the following methodological framework is recommended:

  • Gene Knockout Studies: Generate Daro_2632 deletion mutants in D. aromatica and assess phenotypic changes under various growth conditions, particularly those related to aromatic compound degradation and perchlorate reduction. Complementation studies should be performed to confirm that observed phenotypes are specifically due to the absence of Daro_2632.

  • Transcriptomics and Proteomics: Perform RNA-Seq and mass spectrometry-based proteomics comparing wild-type and Daro_2632 knockout strains to identify genes and proteins whose expression is affected by the absence of Daro_2632. This may reveal co-regulated genes that function in the same pathway.

  • Protein-Protein Interaction Assays: Employ techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or proximity labeling methods like BioID to identify proteins that physically interact with Daro_2632, potentially revealing its position within signaling cascades.

  • Phosphoproteomics: Given the prevalence of two-component signaling systems in bacteria like D. aromatica, analyze changes in the phosphorylation state of proteins between wild-type and Daro_2632 mutant strains to identify potential signaling partners.

  • Metabolomics: Measure changes in metabolite profiles, particularly those related to aromatic compound degradation pathways, to determine if Daro_2632 influences metabolic fluxes in the cell.

Integration of these datasets through computational modeling can construct a comprehensive map of the signaling network involving Daro_2632, providing insights into its functional role within the complex lifestyle of D. aromatica.

How can researchers investigate Daro_2632's potential role in biofilm formation?

Genomic analysis of D. aromatica has revealed evidence for biofilm formation capabilities, including a proposed exopolysaccharide complex and exosortase (epsH) . To investigate whether Daro_2632 plays a role in this process, researchers should adopt the following experimental approaches:

  • Biofilm Assays: Compare biofilm formation between wild-type D. aromatica and Daro_2632 knockout strains using crystal violet staining in microtiter plates or flow cell systems. Quantitative analysis should include measurements of biofilm biomass, thickness, and architecture using confocal laser scanning microscopy.

  • Expression Analysis: Monitor Daro_2632 expression levels during different stages of biofilm development using quantitative RT-PCR or reporter gene fusions. Upregulation during specific phases would suggest functional relevance.

  • Localization Studies: Use fluorescently tagged Daro_2632 (ensuring the tag doesn't interfere with function) to determine its subcellular localization within biofilm structures. Co-localization with known biofilm matrix components would support a direct role in biofilm formation.

  • Matrix Component Analysis: Analyze the composition of extracellular polymeric substances (EPS) in biofilms formed by wild-type and Daro_2632 mutant strains to identify specific changes in polysaccharides, proteins, or extracellular DNA content.

  • Interspecies Biofilm Studies: Given that D. aromatica may interact with an as yet unknown host , investigate biofilm formation in co-culture systems with potential host organisms to determine if Daro_2632 mediates specific interspecies interactions within biofilms.

The data from these experiments can be organized in a comparative table showing quantitative differences in biofilm parameters between wild-type and mutant strains under various environmental conditions, providing clear evidence for Daro_2632's role in biofilm biology.

What experimental designs can assess Daro_2632's potential involvement in D. aromatica's unique aromatic compound degradation pathways?

D. aromatica possesses novel anaerobic aromatic degradation pathways that lack previously characterized "central" enzymes typically associated with these processes . To investigate whether Daro_2632 contributes to these unique pathways, the following experimental design is proposed:

  • Growth Phenotype Analysis: Compare growth rates and yields of wild-type and Daro_2632 knockout strains on various aromatic substrates (benzene, toluene, xylene, chlorobenzoate) under both aerobic and anaerobic conditions. Differential growth would suggest involvement in substrate utilization.

  • Substrate Depletion and Metabolite Accumulation: Measure the rates of aromatic substrate depletion and identify metabolic intermediates that accumulate in wild-type versus knockout strains using GC-MS or LC-MS techniques. This can identify the specific step in the degradation pathway that might be affected by Daro_2632.

  • Enzyme Activity Assays: Develop in vitro assays to test if purified Daro_2632 possesses enzymatic activity toward aromatic compounds or their metabolites, or alternatively, if it regulates the activity of other enzymes in these pathways.

  • Transcriptional Response Analysis: Using RNA-Seq, monitor the transcriptional response to aromatic substrates in wild-type and Daro_2632 knockout strains to identify genes whose induction or repression depends on Daro_2632.

  • Membrane Transport Studies: Investigate whether Daro_2632 functions as a transporter for aromatic compounds or their metabolites by performing uptake assays with radiolabeled substrates in membrane vesicles containing or lacking Daro_2632.

  • Stable Isotope Probing: Use 13C-labeled aromatic substrates to trace carbon flow through metabolic pathways in wild-type and knockout strains, potentially revealing alterations in metabolic flux that implicate Daro_2632 in specific degradation steps.

The results should be presented as a metabolic pathway map indicating the specific steps potentially influenced by Daro_2632, supported by quantitative data showing differences in metabolite concentrations between wild-type and mutant strains.

What biophysical methods are most appropriate for determining the membrane topology of Daro_2632?

Determining the membrane topology of Daro_2632 is crucial for understanding its function. Given its nature as a UPF0060 membrane protein, several complementary biophysical approaches are recommended:

  • Cysteine Scanning Mutagenesis and Accessibility Studies: Systematically replace native amino acids with cysteine residues throughout the protein sequence and assess their accessibility to membrane-impermeable sulfhydryl reagents. Residues exposed to the cytoplasm or periplasm will be more accessible than those buried within the membrane bilayer. This approach can generate a detailed topology map of the protein.

  • Proteolytic Digestion Combined with Mass Spectrometry: Treat intact membrane vesicles containing Daro_2632 with proteases that cannot penetrate the membrane. Only protein regions exposed to the external environment will be digested. Mass spectrometric analysis of the resulting fragments can identify exposed versus protected regions.

  • Fluorescence Spectroscopy with Environment-Sensitive Probes: Introduce fluorescent probes at specific positions within the protein and monitor their spectral properties, which change depending on whether they are located in aqueous or lipid environments.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify regions of the protein that are protected from solvent, corresponding to transmembrane segments or protein-protein interaction interfaces.

  • Cryo-Electron Microscopy (Cryo-EM): For high-resolution structural determination, cryo-EM has emerged as a powerful technique for membrane proteins. By reconstituting Daro_2632 into nanodiscs or amphipols, its structure can be determined at near-atomic resolution, definitively revealing its membrane topology.

Based on preliminary sequence analysis of Daro_2632 (mLELVKVLGLFAITALAEIIGCYLPWLVLTQQRPVWLLIPAAVSLGLFAWLLTLHPGAAGRIYAAYGGVYVAIALIWLWRIDGVVPTRWDLVGSAVSLAGMAIImLQPARSV) , hydrophobicity plots suggest 3-4 potential transmembrane helices, but experimental validation using the methods described above is necessary to confirm this prediction.

How can researchers investigate protein-lipid interactions that may be critical for Daro_2632 function?

Membrane proteins like Daro_2632 often have specific lipid requirements for proper folding, stability, and function. To investigate protein-lipid interactions that may be crucial for Daro_2632, researchers should consider the following methodological approaches:

  • Lipidomics Analysis: Compare the lipid composition of membrane fractions where Daro_2632 is localized versus other cellular membranes using mass spectrometry-based lipidomics. Enrichment of specific lipid species may indicate preferential interactions.

  • Molecular Dynamics Simulations: Perform computational simulations of Daro_2632 embedded in various lipid bilayer compositions to predict preferential lipid interactions and their effects on protein conformation and dynamics.

  • Fluorescence Resonance Energy Transfer (FRET): Utilize FRET between labeled Daro_2632 and fluorescently labeled lipids to detect specific protein-lipid interactions in reconstituted systems.

  • Native Mass Spectrometry: This emerging technique can directly identify lipids that remain bound to membrane proteins during the gentle ionization process, revealing high-affinity lipid interactions.

  • Differential Scanning Calorimetry (DSC): Compare the thermal stability of Daro_2632 reconstituted in different lipid environments to identify compositions that enhance protein stability, suggesting favorable interactions.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Site-directed spin labeling combined with EPR can provide information about the local environment of specific residues and how this environment changes in different lipid compositions.

The data should be presented as both qualitative binding preferences and quantitative affinity measurements (when possible) for different lipid species, potentially revealing lipid-dependent mechanisms of Daro_2632 regulation that are relevant to its biological function in D. aromatica.

What computational approaches can predict functional residues and domains in Daro_2632?

Given the limited experimental data available for Daro_2632, computational approaches can provide valuable insights into functionally important residues and domains. The following computational strategy is recommended:

  • Evolutionary Analysis:

    • Perform multiple sequence alignment of Daro_2632 homologs across diverse bacterial species

    • Calculate conservation scores for each residue using methods like Jensen-Shannon divergence

    • Identify highly conserved residues, which often indicate functional importance

    • Conduct evolutionary coupling analysis to detect co-evolving residue pairs, which may indicate structural or functional relationships

  • Structural Prediction and Analysis:

    • Generate 3D structural models using AlphaFold2 or RoseTTAFold

    • Identify potential binding pockets or cavities using tools like CASTp or POCASA

    • Perform molecular docking simulations with potential ligands based on D. aromatica's metabolic capabilities

    • Analyze electrostatic surface properties to identify potential interaction interfaces

  • Functional Domain Prediction:

    • Apply hidden Markov model (HMM)-based approaches to detect functional domains

    • Use tools like InterProScan to identify conserved domains and motifs

    • Employ machine learning classifiers trained on known membrane protein functions to predict potential roles

  • Network Analysis:

    • Construct gene co-expression networks from available transcriptomic data

    • Identify genes consistently co-expressed with Daro_2632, suggesting functional relationships

    • Perform pathway enrichment analysis on co-expressed genes to infer biological processes

The results from these computational analyses should be integrated and presented as a structural model highlighting predicted functional residues, potential binding sites, and domain organization. This comprehensive computational characterization can guide subsequent experimental validation studies targeting specific residues or regions of Daro_2632.

How can systems biology approaches integrate Daro_2632 into the broader metabolic and signaling networks of D. aromatica?

Understanding the role of Daro_2632 within the broader context of D. aromatica's cellular networks requires integrative systems biology approaches. The following methodological framework is recommended:

  • Multi-omics Data Integration: Combine transcriptomic, proteomic, metabolomic, and phenotypic data from wild-type and Daro_2632 knockout strains using statistical integration methods such as O2PLS (two-way orthogonal partial least squares) or MOFA (multi-omics factor analysis). This integration can reveal coordinated changes across different molecular levels that depend on Daro_2632.

  • Genome-Scale Metabolic Modeling: Incorporate Daro_2632 and its potential functions into a genome-scale metabolic model of D. aromatica. Use flux balance analysis to predict how alterations in Daro_2632 activity might affect metabolic fluxes, particularly in pathways related to aromatic compound degradation.

  • Regulatory Network Reconstruction: Employ algorithms such as ARACNE or CLR to infer gene regulatory networks from expression data, positioning Daro_2632 within the transcriptional regulatory hierarchy of D. aromatica.

  • Protein-Protein Interaction Network Analysis: Map Daro_2632 within the protein interaction network of D. aromatica using experimental data and computational predictions. Apply network analysis metrics such as centrality measures to assess the protein's topological importance.

  • Bayesian Network Modeling: Develop probabilistic models that can predict cellular responses to environmental perturbations based on the state of Daro_2632 and other key regulatory components.

The integrated network should be visualized as a multi-layered graph connecting Daro_2632 to various cellular processes, particularly those related to D. aromatica's unique metabolic capabilities such as anaerobic benzene degradation and perchlorate reduction . This network representation can guide hypothesis generation for further experimental investigation.

What novel experimental technologies could advance our understanding of proteins like Daro_2632?

Emerging technologies offer new opportunities to study challenging membrane proteins like Daro_2632. Researchers should consider incorporating these advanced approaches into their experimental pipeline:

  • Cryo-Electron Tomography: This technique allows visualization of membrane proteins in their native cellular environment at sub-nanometer resolution, providing insights into natural organization and interactions that may be lost in purified systems.

  • Single-Molecule Förster Resonance Energy Transfer (smFRET): By monitoring energy transfer between fluorophores attached to specific residues, smFRET can track conformational changes in real-time, potentially revealing dynamic aspects of Daro_2632 function.

  • Nanobody-Based Structural Biology: Developing camelid nanobodies against Daro_2632 can facilitate crystallization, cryo-EM studies, and even in vivo tracking of the protein, overcoming many traditional challenges in membrane protein structural biology.

  • Cellular Thermal Shift Assay (CETSA): This method can assess ligand binding to Daro_2632 in intact cells by monitoring thermal stability shifts, potentially identifying natural substrates or regulatory molecules.

  • CRISPR Interference (CRISPRi) and CRISPR Activation (CRISPRa): These technologies allow fine-tuned modulation of Daro_2632 expression levels rather than complete knockout, enabling dose-response studies that may reveal threshold-dependent functions.

  • Proximity-Dependent Biotin Identification (BioID) or APEX2: These techniques can map the dynamic protein interaction landscape surrounding Daro_2632 in living cells under various environmental conditions.

  • Microfluidics-Based Single-Cell Analysis: Combining microfluidics with single-cell RNA-seq can reveal cell-to-cell variability in responses to perturbations of Daro_2632, potentially uncovering heterogeneous phenotypes masked in population-level studies.

Implementation of these technologies requires specialized expertise and equipment but can provide unprecedented insights into the structure, dynamics, interactions, and functions of challenging membrane proteins like Daro_2632.

How might insights from Daro_2632 research contribute to biotechnological applications in bioremediation?

D. aromatica's remarkable ability to degrade benzene anaerobically and reduce perchlorate makes it a promising candidate for bioremediation applications . Understanding the role of Daro_2632 could potentially enhance these capabilities through the following biotechnological approaches:

  • Engineered Bioremediation Strains: If Daro_2632 is found to be involved in aromatic compound degradation or perchlorate reduction, overexpression or targeted mutagenesis could create engineered strains with enhanced degradation capabilities. The effectiveness of such modifications should be evaluated in laboratory-scale bioreactors with contaminated soil or groundwater samples.

  • Biosensor Development: Daro_2632 or its regulatory elements could be incorporated into whole-cell biosensors for detecting aromatic pollutants or perchlorate in environmental samples. If Daro_2632 responds to these compounds, reporter gene fusions could translate this response into measurable signals.

  • Enzyme Cascade Systems: If Daro_2632 functions as an enzyme within D. aromatica's novel aromatic degradation pathways, it could be incorporated into in vitro enzyme cascade systems for pollutant transformation outside the constraints of cellular metabolism, potentially achieving higher transformation rates.

  • Biofilm Enhancement Strategies: Should Daro_2632 play a role in biofilm formation, this knowledge could be applied to develop strategies for enhancing biofilm formation in bioremediation systems, improving contaminant removal efficiency in biofilm reactors.

  • Synthetic Biology Approaches: Daro_2632 could be incorporated into synthetic microbial consortia designed for complete mineralization of complex pollutant mixtures, with each consortium member specialized for specific transformation steps.

The potential biotechnological applications should be evaluated not only for technical feasibility but also for environmental safety, considering that engineered systems based on Daro_2632 would be deployed in open environments. Regulatory considerations and containment strategies should be addressed alongside performance metrics.

What strategies can overcome challenges in expressing and purifying sufficient quantities of functional Daro_2632?

Membrane proteins like Daro_2632 present numerous challenges in expression and purification. The following strategies address common obstacles:

  • Expression Host Selection: While E. coli is commonly used for protein expression, membrane proteins often require specialized expression hosts. Consider:

    • Membrane protein-optimized E. coli strains (C41(DE3), C43(DE3))

    • Yeast systems (Pichia pastoris, Saccharomyces cerevisiae)

    • Insect cell expression (Sf9, High Five)

    • Mammalian cell expression using the HSV-1 virion display system

    Each system should be evaluated for Daro_2632 expression using small-scale pilot experiments before scale-up.

  • Fusion Tags and Solubility Enhancers:

    • Test multiple fusion partners (SUMO, MBP, Mistic, GFP)

    • Optimize tag position (N-terminal vs. C-terminal)

    • Include a fluorescent reporter (GFP) to monitor expression and proper folding

    • Consider the Gateway cloning approach with C-terminal V5 tagging as described in the literature

  • Detergent Screening:

    • Systematically test multiple detergent classes (maltosides, glycosides, phosphocholines)

    • Evaluate detergent mixtures that may better mimic native membrane environments

    • Consider newer amphipathic agents (SMALPs, amphipols, nanodiscs) that maintain a more native-like lipid environment

  • Stabilization Strategies:

    • Include stabilizing ligands during purification if known

    • Add lipids that may be required for stability

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Include glycerol (50%) in storage buffers as indicated in the product information

  • Codon Optimization:

    • Adjust codon usage to match the expression host

    • Remove rare codons that may cause translational pausing and misfolding

The table below summarizes the outcomes of different expression and purification strategies that might be applied to Daro_2632:

Expression SystemYield (mg/L culture)Purity (%)Functional ActivityKey AdvantagesMajor Limitations
E. coli C41(DE3)0.5-2.085-90ModerateCost-effective, simplePotential misfolding
Pichia pastoris3.0-5.090-95HighPost-translational modificationsTime-consuming
HSV-1 Display1.0-3.0>95HighNative-like foldingSpecialized equipment
Cell-free system0.1-0.580-85VariableRapid, toxicity-independentExpensive, lower yield

How can researchers address potential functional misinterpretations when studying Daro_2632?

By implementing these methodological safeguards, researchers can minimize misinterpretations and build a more reliable understanding of Daro_2632's function within the complex metabolic and signaling networks of D. aromatica.

What considerations are important when interpreting contradictory data about Daro_2632 function?

Research on novel proteins like Daro_2632 often produces seemingly contradictory results. A systematic approach to resolving such contradictions includes:

  • Methodological Differences Analysis:

    • Compare experimental conditions between contradictory studies (temperature, pH, growth media, etc.)

    • Evaluate differences in protein preparation methods that might affect folding or activity

    • Assess variation in assay sensitivities and detection limits

    • Consider differences in expression systems or host organisms used

  • Multifunctionality Consideration:

    • Investigate whether Daro_2632 might have multiple distinct functions depending on cellular context

    • Consider condition-specific functions that might appear contradictory when compared across different environments

    • Evaluate potential moonlighting functions common in bacterial proteins

  • Interaction Network Dependencies:

    • Examine whether contradictory functions might depend on different interaction partners

    • Map condition-specific protein-protein interactions that might explain functional variation

    • Consider how post-translational modifications might alter function

  • Subcellular Localization Variations:

    • Determine if conflicting functions correlate with different subcellular localizations

    • Investigate potential dynamic relocalization under different conditions

    • Consider domain-specific functions that might appear contradictory when the whole protein is studied

  • Systematic Bias Evaluation:

    • Assess whether contradictions stem from systematic biases in specific methodologies

    • Consider publication bias that might favor certain types of results

    • Evaluate whether incomplete knockouts or silencing might lead to misinterpretation

When presenting contradictory data, researchers should create comprehensive comparison tables that align conflicting observations with methodological differences, proposed reconciliations, and suggested definitive experiments that could resolve the contradictions. This approach transforms apparent contradictions into valuable insights about context-dependent functions of Daro_2632.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.