Recombinant Dehalococcoides ethenogenes Glycerol-3-phosphate acyltransferase 4 (plsY4)

Shipped with Ice Packs
In Stock

Description

GPAT Family Overview

GPAT enzymes initiate glycerolipid synthesis by transferring acyl groups from acyl-CoA to G3P, forming lysophosphatidic acid (LPA). In mammals, GPAT4 isoforms regulate lipid storage and fatty acid oxidation . While bacterial plsY4 shares structural homology with mammalian GPATs, its specific functions remain underexplored.

Potential Roles in Dehalococcoides

  • Lipid Metabolism: Likely involved in membrane phospholipid biosynthesis, critical for maintaining cellular integrity under stress.

  • Syntrophic Interactions: Dehalococcoides strains depend on other microbes for electron donors and cofactors (e.g., corrinoids) . plsY4 may contribute to lipid signaling or energy storage during syntrophic growth.

Comparative Insights

FeatureMammalian GPAT4 Bacterial plsY4
Primary RoleLimiting fatty acid oxidationPutative lipid synthesis
Tissue ExpressionBrown adipose tissueNot characterized
RegulationInsulin-responsiveUnknown

Production and Handling

  • Reconstitution: Recommended in deionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for long-term storage (-20°C/-80°C) .

  • Purity Assurance: SDS-PAGE confirms >90% purity, but repeated freeze-thaw cycles degrade activity .

Research Gaps

  • Functional Studies: No direct evidence links plsY4 to reductive dehalogenation or syntrophic partnerships.

  • Substrate Specificity: Acyl-CoA preferences (e.g., palmitoyl, oleoyl) remain uncharacterized.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
plsY4; DET1445; Glycerol-3-phosphate acyltransferase 4; Acyl-PO4 G3P acyltransferase 4; Acyl-phosphate--glycerol-3-phosphate acyltransferase 4; G3P acyltransferase 4; GPAT 4; Lysophosphatidic acid synthase 4; LPA synthase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) (Dehalococcoides ethenogenes (strain 195))
Target Names
plsY4
Target Protein Sequence
MPLLFVLLSYLLGTFPSAYLAGYLSTDRDIRLMGDHNMGAQNAYRCLGRGWGLAVFVFDL AKGSLAITLALAAGLSPGWVMFCGLAAVLGHNWPVWLGFRGGRGEATAIGVMLLIATQPM LIMGGLGLLVLLFTSSVIAASAVMFGLLWLAVILYGLPGGVVAYSIGLPVVVGLTHFIRS RKNRL
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: det:DET1445

STRING: 243164.DET1445

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Dehalococcoides ethenogenes and why is it significant for bioremediation research?

Dehalococcoides ethenogenes is a strictly anaerobic bacterium that plays a crucial role in the reductive dechlorination of chlorinated compounds. Its significance stems from its unique ability to catabolize many of the most toxic and persistent chlorinated aromatics and aliphatics through reductive dechlorination . This bacterium is particularly valuable for in situ bioremediation of contaminated sites .

Dehalococcoides species are known to use chlorinated compounds as electron acceptors and hydrogen as an electron donor for growth, occupying a specialized ecological niche . D. ethenogenes is a member of the physiologically diverse division of green nonsulfur bacteria . The genome sequence of D. ethenogenes has revealed the presence of numerous reductive-dehalogenase-homologous (rdh) genes, which confer substantial dehalogenating potential .

What is the function of Glycerol-3-phosphate acyltransferase 4 and where is it localized in cells?

Glycerol-3-phosphate acyltransferase 4 (GPAT4) catalyzes the first and rate-limiting step in the de novo pathway of glycerolipid synthesis by converting glycerol-3-phosphate and long-chain acyl-CoA to lysophosphatidic acid (LPA) . This reaction is crucial as LPA serves as a precursor for the biosynthesis of phosphatidic acid, diacylglycerol (DAG), and triacylglycerol (TAG) .

Regarding subcellular localization, GPAT4 in mammals is targeted to the endoplasmic reticulum (ER) membrane, categorizing it as a microsomal GPAT . Interestingly, recent studies have shown that GPAT4 isoforms from Drosophila melanogaster and mammals can be relocalized from the ER to the surface of nascent lipid droplets, where they mediate lipid droplet growth .

How does NEM sensitivity distinguish between different GPAT isoforms?

N-ethylmaleimide (NEM) sensitivity is a key characteristic used to differentiate between GPAT isoforms. In mammals, GPAT isoforms are classified into two categories:

  • NEM-resistant: GPAT1 is resistant to inactivation by NEM

  • NEM-sensitive: GPAT isoforms 2, 3, and 4 are inactivated by NEM

This differential sensitivity to NEM serves as an important biochemical tool for distinguishing between GPAT activities in experimental settings. When conducting GPAT activity assays, researchers often measure total activity and then subtract the activity remaining after NEM treatment (corresponding to GPAT1) to determine the contribution of NEM-sensitive isoforms (GPAT2, 3, and 4) .

What expression patterns have been observed for GPAT4 during development?

Expression studies of GPAT4 in mouse testis have revealed distinct temporal patterns during postnatal development:

  • GPAT4 is first expressed at 2 weeks postnatally

  • Expression becomes abundant from the third week

  • Expression plateaus at weeks 5-6

  • It maintains a high level in adult tissues

In situ hybridization (ISH) studies have shown that GPAT4 gene is expressed abundantly in spermatocytes and around spermatids during meiosis, but not in elongated spermatids during later spermiogenesis . This expression pattern suggests a developmental role for GPAT4 in specific stages of spermatogenesis, particularly during mid-meiosis.

What are the essential components of an experimental design to study recombinant GPAT4 activity?

An effective experimental design for studying recombinant GPAT4 activity should follow these five key steps:

  • Variable Consideration: Define independent variables (e.g., substrate concentration, pH, temperature) and dependent variables (e.g., enzyme activity, product formation)

  • Hypothesis Formulation: Develop a specific, testable hypothesis about GPAT4 function or activity

  • Treatment Design: Create experimental treatments to manipulate independent variables systematically

  • Group Assignment: Assign experimental units to either between-subjects or within-subjects designs

  • Measurement Planning: Establish clear protocols for measuring dependent variables

For valid experimental results, it's crucial to select a representative sample and control extraneous variables that might influence outcomes. When random assignment is impossible, unethical, or highly difficult, consider implementing an observational study instead to minimize research bias .

What methods are commonly used for analyzing GPAT4 enzyme kinetics?

Standard methods for analyzing GPAT4 enzyme kinetics typically include:

Radiometric Assay Protocol:

  • Prepare reaction mixture containing radiolabeled glycerol-3-phosphate and acyl-CoA substrate

  • Initiate reaction by adding membrane protein (10 μg for cells or 5-50 μg for tissue)

  • Incubate membrane protein on ice for 15 min with or without 2 mM N-ethylmaleimide (NEM)

  • Extract reaction products into CHCl₃

  • Dry under N₂ and resuspend in scintillation fluid

  • Count in a scintillation counter

NEM-resistant activity (attributed to GPAT1) is calculated by subtracting NEM-sensitive activity from total activity, allowing researchers to determine the specific contribution of GPAT4 .

How can recombinant expression systems be optimized for Dehalococcoides proteins?

Optimizing recombinant expression systems for Dehalococcoides proteins requires specific strategies to address the challenges associated with this strictly anaerobic bacterium:

  • Vector Selection: Use vectors with appropriate promoters for anaerobic expression systems

  • Host Selection: For complementation studies, E. coli mutant strains with specific deficiencies can be used to test functional activity of recombinant proteins

  • Expression Conditions: Maintain strictly anaerobic conditions during expression to ensure proper protein folding and activity

  • Verification Methods:

    • Complementation assays to test functional rescue in deficient host strains

    • Activity assays using specific substrates to confirm enzymatic function

    • Western blotting to verify protein expression levels

  • Co-expression Considerations: When necessary, co-express chaperones or other auxiliary proteins that may be required for proper folding or activity

For example, when testing reductive dehalogenase activities, researchers have successfully used E. coli fabB(Ts) fabF strain CY244 for complementation studies, where growth at 42°C in the presence of oleate indicates complementation of the fabF mutation .

How can transcriptomic and proteomic approaches be integrated to study Dehalococcoides metabolic networks?

Integrating transcriptomic and proteomic approaches provides a systems-level understanding of Dehalococcoides metabolic networks. A comprehensive methodology includes:

  • Experimental Setup:

    • Culture Dehalococcoides under varying conditions (e.g., different electron acceptors, nutrient limitations)

    • Collect samples for parallel transcriptomic and proteomic analyses at defined time points

  • Transcriptomic Analysis:

    • Perform RNA extraction optimized for low-biomass anaerobic cultures

    • Create shotgun metagenome microarrays to investigate gene transcription

    • Identify differentially expressed genes related to specific metabolic functions

  • Proteomic Analysis:

    • Extract and fractionate proteins from cellular compartments

    • Perform mass spectrometry-based proteomic analysis

    • Quantify protein abundance changes in response to experimental conditions

  • Integrated Data Analysis:

    • Correlate transcriptomic and proteomic data to identify concordant and discordant responses

    • Map findings to metabolic pathways to identify regulatory networks

    • Use statistical approaches to distinguish significant changes from experimental noise

  • Validation:

    • Confirm key findings using targeted approaches (qPCR, Western blotting)

    • Test hypotheses generated from omics data using biochemical assays

For example, researchers studying Dehalococcoides have successfully used microarray analysis to identify upregulation of vinyl chloride reductase gene vcrA during vinyl chloride dechlorination, while also observing unexpected upregulation of other reductive dehalogenase homologous sequences during starvation conditions .

How does chlorinated electron acceptor abundance affect Dehalococcoides population dynamics?

Chlorinated electron acceptor abundance significantly influences Dehalococcoides population dynamics and gene expression patterns:

  • Population Selection: Different Dehalococcoides strains are selected based on available chlorinated electron acceptors. Quantitative PCR analysis of reductive dehalogenase genes to 16S rDNA ratios reveals:

    • VC enrichments show the lowest diversity of rdhA sequences

    • cDCE enrichments form distinct clusters characterized by significant abundance of the bvcA gene

    • 1,2-DCA enrichments show high ratios for specific rdhA genes (KB1-16, KB1-17, KB1-19, KB1-25) and tceA

    • TCE cultures reflect a blend of all other enrichments

  • Gene Expression Patterns: Different chlorinated electron acceptors drive distinct gene expression profiles:

    • During vinyl chloride dechlorination, vcrA shows higher transcript levels

    • During starvation, multiple reductive dehalogenase genes show increased expression

  • Strain Dynamics: Even in highly enriched cultures dechlorinating a single compound, multiple Dehalococcoides populations can coexist, suggesting complex ecological interactions beyond simply utilizing the available electron acceptor

These findings have important implications for understanding Dehalococcoides ecology and for optimizing bioremediation strategies using these organisms.

What are the common challenges in purifying recombinant membrane proteins like GPAT4?

Purifying recombinant membrane proteins like GPAT4 presents several technical challenges:

  • Solubilization Issues:

    • Membrane proteins require detergents for solubilization

    • Finding the optimal detergent that maintains protein structure and function is critical

    • Different detergents may be required for extraction versus purification steps

  • Expression Limitations:

    • Overexpression of membrane proteins can be toxic to host cells

    • Membrane protein insertion machinery may become saturated

    • Proteins may aggregate in inclusion bodies if expression exceeds insertion capacity

  • Stability Concerns:

    • Membrane proteins often show reduced stability when removed from their native lipid environment

    • Addition of specific lipids during purification may be necessary to maintain function

    • Buffer optimization is critical to prevent aggregation and denaturation

  • Activity Preservation:

    • Retention of enzymatic activity is particularly challenging for multi-domain membrane proteins

    • NEM sensitivity of GPAT4 requires careful handling to prevent inadvertent inactivation

    • Reconstitution into liposomes may be necessary to accurately measure activity

  • Purification Strategy:

    • Traditional chromatography approaches may need modification for membrane proteins

    • Multiple chromatography steps often result in significant loss of protein

    • Affinity tags must be positioned to remain accessible when the protein is in detergent micelles

How can contradictory results in GPAT4 functional studies be resolved?

Resolving contradictory results in GPAT4 functional studies requires a systematic approach:

  • Experimental Design Evaluation:

    • Review experimental design for potential confounding variables

    • Ensure proper controls were included in all experiments

    • Consider between-subjects vs. within-subjects design implications

  • Methodological Analysis:

    • Compare assay conditions across studies (substrate concentrations, pH, temperature)

    • Evaluate differences in protein expression systems

    • Consider how NEM sensitivity was assessed across studies

  • Replication Strategy:

    • Implement independent biological replicates to capture natural variation

    • Use technical replicates to assess methodological reproducibility

    • Calculate appropriate statistical power to detect meaningful differences

  • Data Presentation Approaches:

    • Present contradictory data in clear, unbiased tabular or graphical format

    • Use appropriate statistical analyses to quantify significance of differences

    • Consider preparing tables that explicitly compare methodological differences between studies9

  • Reconciliation Framework:

    • Propose hypotheses that could explain contradictory results

    • Design experiments specifically to test these hypotheses

    • Consider if differences reflect biological relevance rather than experimental error

ApproachAdvantagesLimitations
Independent validation by multiple labsEliminates lab-specific biasesResource-intensive, time-consuming
Multiple analytical techniquesProvides orthogonal evidenceRequires diverse technical expertise
Systematic parameter variationIdentifies condition-dependent effectsMay require large experimental matrix
Meta-analysisLeverages existing dataDependent on reporting quality
In vivo validationTests physiological relevanceMay introduce new variables

What are the best practices for designing tables and figures when reporting GPAT4 research results?

Effective tables and figures are essential for clearly communicating GPAT4 research results:

  • Table Design Best Practices:

    • Include clear, informative titles that describe the content9

    • Use consistent formatting with appropriate column headers

    • Include units of measurement for all numerical data

    • Indicate statistical significance using standardized notation (e.g., asterisks)2

    • Include table notes to explain abbreviations or methodology2

    • Ensure adequate column width to prevent crowding of data2

  • Figure Design Best Practices:

    • Choose appropriate figure types for different data:

      • Line graphs for trends over time or dose-response relationships

      • Bar graphs for comparing discrete categories

      • Scatter plots for correlation analyses

    • Include clear axes labels with units9

    • Use error bars to indicate variation or uncertainty9

    • Ensure text within figures is legible when sized for publication9

    • Provide detailed figure captions that allow understanding without referring to the main text9

  • Decision Framework:

    • Use tables when precise numerical values are important

    • Use figures when patterns, trends, or relationships are the focus

    • Consider whether your data answers "what" (table) or "how" (figure) questions9

  • Common Mistakes to Avoid:

    • Overcrowding tables with too much information

    • Using inappropriately scaled axes that distort data interpretation

    • Omitting essential statistical information

    • Creating figures that require color to interpret (problematic for color-blind readers or black-and-white printing)

How might synthetic biology approaches enhance the study of GPAT4 in Dehalococcoides?

Synthetic biology approaches offer promising avenues for advancing GPAT4 research in Dehalococcoides:

  • Gene Editing Systems:

    • Development of CRISPR-Cas9 systems adapted for anaerobic bacteria

    • Creation of inducible gene expression systems for temporal control of GPAT4

    • Site-directed mutagenesis to investigate structure-function relationships

  • Synthetic Constructs:

    • Design of chimeric GPAT enzymes to investigate domain functions

    • Creation of reporter fusions to monitor GPAT4 expression and localization

    • Development of synthetic operons to coordinate expression of GPAT4 with related metabolic genes

  • Heterologous Expression Platforms:

    • Optimization of expression in model organisms under anaerobic conditions

    • Development of cell-free systems for rapid prototyping of GPAT4 variants

    • Creation of minimal synthetic cells with defined lipid metabolism pathways

  • Functional Screening Approaches:

    • High-throughput assays for GPAT4 activity using synthetic substrates

    • Selection systems based on complementation of GPAT-deficient strains

    • Metabolic flux analysis using isotopically labeled precursors

  • Systems Biology Integration:

    • Genome-scale metabolic models incorporating GPAT4 function

    • Prediction of metabolic network responses to GPAT4 modulation

    • Design of synthetic consortia with engineered lipid metabolism properties

What are the implications of GPAT4 function for bioremediation applications using Dehalococcoides?

The function of GPAT4 in Dehalococcoides has several important implications for bioremediation applications:

  • Membrane Composition and Environmental Adaptation:

    • GPAT4's role in phospholipid synthesis could influence membrane composition

    • Membrane properties affect tolerance to contaminants and environmental stressors

    • Engineered modifications to GPAT4 might enhance cell survival in contaminated environments

  • Metabolic Engineering Opportunities:

    • Modification of GPAT4 activity could alter lipid metabolism and energy flux

    • Optimized TAG synthesis might improve energy storage for periods of substrate limitation

    • Enhanced membrane phospholipid production could support faster cell growth and division

  • Bioaugmentation Strategies:

    • Understanding GPAT4's role in cell growth could improve cultivation strategies

    • Engineered strains with optimized GPAT4 expression might show enhanced persistence

    • Co-cultivation with supporting organisms might provide essential lipid precursors

  • Monitoring and Assessment:

    • GPAT4 expression levels could serve as biomarkers for metabolic activity

    • Lipid profiles might indicate the physiological state of Dehalococcoides populations

    • Improved understanding of lipid metabolism could lead to new growth-stimulating amendments

  • Integration with Other Dechlorination Processes:

    • Understanding the relationship between lipid metabolism and reductive dehalogenase activity

    • Potential for coordinated regulation of GPAT4 and rdhA genes under different conditions

    • Development of bioremediation strategies that optimize both growth and dechlorination activity

This research direction represents an important intersection between fundamental biochemistry and applied environmental biotechnology, with potential for significant impacts on bioremediation practice.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.