Recombinant Dehalococcoides ethenogenes Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
lspA; DET1374; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) (Dehalococcoides ethenogenes (strain 195))
Target Names
lspA
Target Protein Sequence
MTRGLVFFVSAACGVLADQLSKFIIAANLTPGTAIPESGFFQIVHVHNTGAAFSIFRGHT EWLIAASCLGVILALTAFFLRKKLPFLDTRPGVAALGIILAGTIGNLIDRVRLGYVTDFI QVGNFPTFNMADSCLTLGIIWLVLLYLTSSHSGGDASENA
Uniprot No.

Target Background

Function
This protein is a recombinant *Dehalococcoides ethenogenes* lipoprotein signal peptidase (LspA) that specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: det:DET1374

STRING: 243164.DET1374

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of lipoprotein signal peptidase (lspA) in Dehalococcoides ethenogenes?

Lipoprotein signal peptidase (lspA) in Dehalococcoides ethenogenes functions as a specialized enzyme that processes prolipoproteins by cleaving signal peptides during lipoprotein maturation. This type II signal peptidase specifically recognizes the characteristic lipobox motif in the signal sequence and cleaves immediately before the cysteine residue that becomes lipidated. While not directly identified in the provided proteomic studies, lspA likely plays a critical role in the membrane biology of D. ethenogenes similar to other bacteria, where it contributes to proper localization of lipoproteins involved in diverse functions including substrate transport, respiratory processes, and cell wall maintenance.

The importance of membrane proteins in Dehalococcoides species is evident from comparative proteomic analyses that identified numerous membrane-associated proteins crucial for reductive dehalogenation processes, including reductive dehalogenases (RDases) and putative electron transport components . The proper processing and localization of these membrane proteins, potentially facilitated by lspA, is essential for the organism's unique metabolic capabilities.

How does lspA in Dehalococcoides ethenogenes compare to signal peptidases in other bacterial species?

Lipoprotein signal peptidase in Dehalococcoides ethenogenes shares fundamental catalytic mechanisms with other bacterial type II signal peptidases but possesses distinct characteristics reflecting the unique membrane biology of this specialized organism. Unlike the more extensively studied lspA proteins from model organisms like E. coli or B. subtilis, the D. ethenogenes lspA likely contains adaptations specific to the unusual cell envelope structure of this organism.

While comparative proteomic analyses have identified numerous membrane proteins in Dehalococcoides species, including S-layer proteins with high coverage (37% protein sequence coverage in pure cultures) , specific characterization of lspA has not been extensively reported. The protein would be expected to contain the conserved catalytic residues (typically aspartate and lysine) found in other bacterial lspA enzymes, but potentially with sequence adaptations reflecting the unique lipid composition and membrane architecture of Dehalococcoides.

The high conservation of housekeeping genes in Dehalococcoides species (>85% identical at amino acid level) suggests that lspA may be similarly conserved across different strains, in contrast to the highly variable reductive dehalogenase genes that confer strain-specific metabolic capabilities.

What experimental systems are suitable for expressing recombinant Dehalococcoides ethenogenes lspA?

For recombinant expression of Dehalococcoides ethenogenes lspA, researchers should consider systems that accommodate the expression of membrane-associated proteins with potential toxicity. Based on approaches used for similar challenging proteins, the following expression systems can be considered:

  • E. coli-based systems with tight regulation: Expression vectors with tightly controlled inducible promoters (like pET systems with T7lac promoters) can help manage potential toxicity. Strains like C41(DE3) or C43(DE3), specifically designed for toxic membrane protein expression, offer advantages over conventional BL21(DE3).

  • Cell-free expression systems: These bypass toxicity issues entirely and allow direct synthesis of membrane proteins in the presence of detergents or lipid environments.

  • Low-temperature expression protocols: Induction at reduced temperatures (16-20°C) with lower inducer concentrations can improve folding and reduce aggregation.

The proteomic analysis methods used for identifying Dehalococcoides membrane proteins, including gel electrophoresis followed by liquid chromatography-tandem mass spectrometry (LC-MS-MS), provide a foundation for detecting and characterizing recombinant lspA . These approaches demonstrated success in identifying low-abundance membrane proteins from both pure and mixed cultures of Dehalococcoides species.

What are the best methods to assess the activity of recombinant lspA from Dehalococcoides ethenogenes?

Assessing recombinant Dehalococcoides ethenogenes lspA activity requires specialized approaches targeting its signal peptide cleavage function. The following methodological framework is recommended:

  • Synthetic peptide substrate assay: Design fluorogenic peptide substrates containing the lipobox motif with a fluorophore-quencher pair that produces measurable signals upon cleavage. This provides quantitative activity measurements and allows kinetic analysis.

  • Mass spectrometry-based assays: Use LC-MS to detect and quantify cleavage products from model prolipoproteins. Similar MS approaches have successfully identified various proteins in Dehalococcoides, with coverage estimates demonstrating a strong linear relationship for both percent coverage and emPAI values in proteomic studies .

  • Complementation studies: Test functional activity by expressing D. ethenogenes lspA in conditional lspA mutants of model organisms (typically temperature-sensitive mutants), assessing restoration of lipoprotein processing.

  • In vivo prolipoprotein processing: Express tagged model prolipoproteins alongside recombinant lspA and monitor processing through size shifts detectable by western blotting.

When designing activity assays, researchers should consider the potential requirements for specific membrane environments, as the proteomic studies of Dehalococcoides emphasized the importance of membrane-enriched fractions for detecting key functional proteins .

How can site-directed mutagenesis be used to identify catalytic residues in Dehalococcoides ethenogenes lspA?

Site-directed mutagenesis of Dehalococcoides ethenogenes lspA provides a powerful approach to elucidate structure-function relationships in this specialized signal peptidase. The following comprehensive methodology is recommended:

  • Sequence alignment and predictive modeling: Begin by aligning the D. ethenogenes lspA sequence with well-characterized homologs to identify conserved residues. Focus particularly on the predicted catalytic aspartate and lysine residues found in the consensus sequences of bacterial type II signal peptidases.

  • Systematic mutagenesis strategy: Implement a three-tiered mutagenesis approach:

    • Conservative substitutions (e.g., Asp→Glu, Lys→Arg) to assess the importance of specific functional groups

    • Non-conservative substitutions (e.g., Asp→Ala, Lys→Ala) to eliminate side chain functionality

    • Cysteine-scanning mutagenesis of transmembrane regions to map membrane topology

  • Activity correlation with structural features: Combine activity measurements of mutants with structural predictions to map the catalytic site. Similar protein structure-function approaches have been valuable in understanding membrane proteins in Dehalococcoides, such as the reductive dehalogenases that show strain-specific functional variations despite high sequence similarity in some regions .

  • Expression level normalization: To ensure valid comparison between mutants, normalize activity measurements to expression levels quantified by western blotting or targeted MS approaches similar to those used in the emPAI quantification of Dehalococcoides proteins .

The mutational analysis should be interpreted within the context of the unique membrane environment of Dehalococcoides, as proteomic studies have highlighted distinctive membrane protein compositions that differ between Dehalococcoides strains .

What role might lspA play in the assembly of respiratory complexes in Dehalococcoides ethenogenes?

The lipoprotein signal peptidase (lspA) likely plays a crucial indirect role in assembling respiratory complexes in Dehalococcoides ethenogenes by processing specific lipoproteins essential for these systems. While not directly involved in catalyzing respiratory reactions, lspA's function in lipoprotein maturation has significant implications for respiratory machinery assembly and function.

Proteomic analyses of Dehalococcoides species have identified numerous respiratory components, including reductive dehalogenases (RDases) like PceA and TceA, and electron transport proteins such as hydrogenases and formate dehydrogenase-like proteins . Many respiratory complexes in bacteria require accessory lipoproteins for proper assembly, stability, or function. By correctly processing these accessory lipoproteins, lspA likely contributes to:

  • Assembly of RDase complexes: Proper membrane anchoring of RDase complexes, which are key respiratory enzymes in Dehalococcoides, may require correctly processed lipoproteins. Comparative proteomic studies showed high coverage of PceA and TceA RDases in membrane fractions of Dehalococcoides strains under different growth conditions .

  • Hydrogenase maturation: Hydrogenase components were detected in multiple Dehalococcoides cultures , and in many bacteria, hydrogenase assembly requires specific lipoproteins that may be processed by lspA.

  • Respiratory chain integrity: The interconnection between lipoproteins and respiratory complexes suggests that defects in lspA activity could broadly impact electron transport efficiency across the Dehalococcoides membrane.

The relationship between lspA activity and respiratory function could be experimentally assessed through controlled expression studies where lspA activity is modulated while monitoring respiratory complex assembly and function.

How does the substrate specificity of lspA from Dehalococcoides ethenogenes compare to other strains within the genus?

The substrate specificity of lipoprotein signal peptidase (lspA) likely shows subtle variations across different Dehalococcoides strains, reflecting strain-specific adaptations in membrane biology and lipoprotein utilization patterns. While direct comparative studies of lspA specificity are not documented in the provided references, insights can be derived from the proteomic diversity observed among Dehalococcoides strains.

Comparative proteomic analyses revealed that while housekeeping genes in Dehalococcoides strains show high conservation (>85% identity at amino acid level), functional diversity exists in membrane-associated proteins . This suggests that lspA from D. ethenogenes may recognize a somewhat distinctive set of lipoprotein signal sequences compared to other strains.

A methodological approach to characterize these differences would include:

  • Comparative signal sequence analysis: Compile predicted lipoprotein signal sequences from different Dehalococcoides strains (195, CBDB1, BAV1, VS, etc.) and analyze variations in the lipobox motif and surrounding regions.

  • Cross-species processing assays: Express recombinant lspA from different Dehalococcoides strains and test their ability to process a standardized panel of lipoprotein substrates from various strains.

  • Chimeric enzyme studies: Create hybrid lspA proteins with domains from different Dehalococcoides strains to identify regions responsible for substrate discrimination.

The table below summarizes predicted differences in lspA characteristics across key Dehalococcoides strains based on their general proteomic patterns:

StrainPredicted lspA CharacteristicsNotable Lipoproteins Detected in ProteomicsPotential Adaptation
195High activity with diverse substratesPceA, TceA, HupL, Fdh-like proteins Broad substrate range reflecting versatile metabolism
CBDB1Possibly more selectivePceA homolog (cbdbA1588), S-layer proteins Specialized for aromatic dehalogenation substrates
KB1May recognize VcrA-associated lipoproteinsRdhA14 homologs, hydrogenase components Adapted for vinyl chloride metabolism
SRNLSimilar to KB1 patternRdhA14/VcrA homologs Focus on lower chlorinated ethene substrates

What structural modifications could enhance the stability of recombinant Dehalococcoides ethenogenes lspA for crystallization studies?

Enhancing the stability of recombinant Dehalococcoides ethenogenes lspA for crystallization studies requires strategic structural modifications that address the inherent challenges of membrane protein crystallography. Based on successful approaches with other challenging membrane proteins, the following methodological framework is recommended:

  • Terminal fusion constructs:

    • N-terminal fusions: Consider T4 lysozyme or BRIL (thermostabilized apocytochrome b562) insertions after careful identification of the signal sequence

    • C-terminal fusions: GFP or MBP fusions can improve folding and provide convenient purification handles

    • Both termini should be engineered only after careful topology mapping to avoid disrupting membrane integration

  • Targeted surface engineering:

    • Surface entropy reduction (SER): Identify and mutate surface-exposed flexible loops containing clusters of high-entropy residues (Lys, Glu, Gln) to alanine

    • Introduction of additional disulfide bonds in periplasmic domains to reduce conformational flexibility

    • Removal of post-translational modification sites that could create heterogeneity

  • Thermostability enhancement:

    • Implement directed evolution approaches using FSEC (fluorescence-detection size-exclusion chromatography) as a screening method

    • Apply computational design to identify stabilizing mutations, particularly at domain interfaces

    • Consider consensus-based design from alignment of lspA sequences across diverse bacterial species

  • Lipid-protein interface optimization:

    • Screening with lipid-like detergents and native-like lipid mixtures

    • Co-crystallization with lipids identified in Dehalococcoides membranes

    • Application of lipidic cubic phase or bicelle crystallization methods

The importance of membrane environment for Dehalococcoides proteins is highlighted by proteomic studies that successfully identified membrane-associated proteins using specialized extraction methods . Similar approaches should be considered when handling recombinant lspA for structural studies.

How can transcriptomic and proteomic approaches be integrated to understand lspA regulation in Dehalococcoides ethenogenes under different growth conditions?

Integrating transcriptomic and proteomic approaches to understand lspA regulation in Dehalococcoides ethenogenes requires a multilayered experimental design that captures both expression dynamics and functional outcomes. The following methodological framework builds on established approaches used for studying other Dehalococcoides genes:

  • Coordinated sampling protocol:

    • Implement synchronized sampling of cultures grown with different electron acceptors (e.g., PCE, TCE, DCE, vinyl chloride)

    • Collect parallel samples for RNA extraction (transcriptomics) and protein isolation (proteomics)

    • Include pure culture and mixed community conditions to assess community effects, similar to the comparative analyses performed for other Dehalococcoides proteins

  • Multi-omics analytical pipeline:

    • Quantitative RT-PCR targeting lspA transcripts, normalized to validated reference genes

    • RNA-Seq for global transcriptional context surrounding lspA expression

    • Targeted proteomics using multiple reaction monitoring (MRM) to quantify lspA protein

    • Global proteomics to identify co-regulated proteins, especially lipoproteins that are lspA substrates

  • Correlation analysis framework:

    • Calculate transcript-to-protein ratios across conditions to identify post-transcriptional regulation

    • Implement time-series experiments to capture temporal dynamics and delays between transcription and translation

    • Apply network analysis to identify regulators and co-regulated gene clusters

  • Functional validation approaches:

    • Monitor processing of selected lipoprotein substrates in parallel with lspA expression

    • Correlate lspA levels with membrane proteome composition and stability

    • Assess impact of modified lspA expression on growth and dehalogenation rates

This integrated approach builds upon methods successfully applied in studying Dehalococcoides, where proteomic analyses effectively identified key functional proteins and their relative abundances across different growth conditions . The emPAI values used to estimate protein concentrations in LC-MS-MS experiments provide a quantitative framework that can be extended to study lspA regulation.

What are the optimal conditions for solubilizing and purifying recombinant Dehalococcoides ethenogenes lspA?

Developing optimal conditions for solubilizing and purifying recombinant Dehalococcoides ethenogenes lspA requires a systematic approach addressing the challenges inherent to membrane protein biochemistry. Based on successful strategies with similar proteins, the following comprehensive protocol is recommended:

  • Expression system optimization:

    • Use C41(DE3) or C43(DE3) E. coli strains specifically designed for membrane protein expression

    • Implement low-temperature induction (16-18°C) with reduced IPTG concentrations (0.1-0.2 mM)

    • Consider codon optimization for the expression host, particularly for rare codons

  • Membrane extraction and solubilization:

    • Primary screening of detergents across different classes:

      • Mild non-ionic (DDM, LMNG)

      • Zwitterionic (LDAO, Fos-choline)

      • Steroid-based (cholate derivatives)

    • Secondary optimization of detergent concentration, temperature, and time

    • Addition of lipids (0.1-0.2 mg/ml) during solubilization to maintain native-like environment

  • Purification strategy:

    • Implement a three-step chromatography approach:

      • IMAC (immobilized metal affinity chromatography) as initial capture step

      • Ion exchange chromatography as intermediate purification

      • Size exclusion chromatography as final polishing and buffer exchange step

    • Maintain detergent concentration above CMC throughout all steps

    • Include glycerol (10-20%) to enhance stability

  • Quality assessment metrics:

    • Size exclusion chromatography to evaluate monodispersity

    • Circular dichroism to confirm secondary structure

    • Thermal stability assays (DSF or nanoDSF) to identify stabilizing conditions

    • Activity assays using synthetic peptide substrates to confirm functional state

This methodology draws from principles applied in the analysis of membrane-enriched fractions from Dehalococcoides cultures, where specialized extraction techniques successfully preserved functional integrity of membrane proteins . The emphasis on maintaining a native-like lipid environment reflects the observation that membrane context significantly impacts the detection and presumably function of Dehalococcoides membrane proteins .

How can isotope labeling strategies be applied to study lspA interactions with its substrates in Dehalococcoides ethenogenes?

Isotope labeling offers powerful approaches to investigate lspA interactions with substrate proteins in Dehalococcoides ethenogenes, enabling detailed structural and dynamic insights. The following comprehensive methodological framework leverages specialized labeling techniques:

  • Selective isotope labeling strategies:

    • SILAC (Stable Isotope Labeling by Amino acids in Cell culture): Incorporate 13C/15N-labeled amino acids into substrate prolipoproteins while maintaining unlabeled lspA, or vice versa

    • Methyl-specific labeling: Introduce 13CH3 groups on methionine and isoleucine residues for NMR studies of large complexes

    • Segmental isotope labeling: Generate chimeric proteins where only specific domains are isotopically labeled using protein trans-splicing

  • Advanced structural biology applications:

    • Cross-linking Mass Spectrometry (XL-MS): Apply isotope-coded cross-linkers to capture transient lspA-substrate interactions, followed by MS analysis to map contact points

    • HDX-MS (Hydrogen-Deuterium Exchange): Monitor changes in hydrogen-deuterium exchange rates upon substrate binding to identify interaction interfaces

    • NMR spectroscopy: Implement TROSY-based experiments with selectively labeled samples to characterize binding dynamics

  • Real-time enzymatic assay designs:

    • Pulse-chase experiments: Pulse with heavy isotope-labeled amino acids followed by chase with light amino acids to track substrate processing kinetics

    • Single-turnover kinetics: Pre-steady state kinetic analysis using rapid quench-flow techniques with isotope-labeled substrates

    • 15N-HSQC fingerprinting: Monitor chemical shift perturbations upon substrate binding to map the interaction interface

  • In vivo interaction mapping:

    • BONCAT (Bio-Orthogonal Non-Canonical Amino Acid Tagging): Incorporate azide-containing amino acids into newly synthesized proteins for selective enrichment and identification of lspA processing targets

    • Ribosome profiling: Combine with selective labeling to correlate translation dynamics with substrate processing

These methods build upon proteomic approaches previously applied to Dehalococcoides, where LC-MS-MS successfully identified membrane proteins and their abundance patterns . The application of advanced isotope labeling would extend these techniques to capture the dynamics of enzyme-substrate interactions, providing mechanistic insights into lspA function.

What are the most effective approaches for analyzing the impact of lspA knockout or overexpression on the Dehalococcoides ethenogenes membrane proteome?

Analyzing the impact of lspA manipulation on the Dehalococcoides ethenogenes membrane proteome requires sophisticated comparative proteomic approaches combined with functional assessments. The following comprehensive methodology would yield the most informative results:

  • Genetic manipulation strategies:

    • For knockout studies: Implement CRISPR-Cas9 with homology-directed repair or traditional homologous recombination to generate conditional knockouts

    • For overexpression: Develop inducible expression systems with titratable promoters to achieve controlled lspA expression levels

    • Create complementation strains expressing wild-type or catalytically inactive lspA variants

  • Quantitative membrane proteomics workflow:

    • Implement a multiplexed quantitative approach using:

      • TMT (Tandem Mass Tag) or iTRAQ labeling for high-throughput comparison

      • Label-free quantification with multiple biological replicates

      • SILAC labeling for direct relative quantification

    • Focus on membrane-enriched fractions using established protocols that have successfully identified Dehalococcoides membrane proteins

    • Apply specialized detergent-based extraction methods optimized for hydrophobic proteins

  • Data analysis framework:

    • Categorize proteins with altered abundance into functional classes:

      • Direct lspA substrates (lipoproteins showing processing defects)

      • Secondary effects (non-lipoprotein membrane components affected indirectly)

      • Compensatory responses (proteins upregulated to compensate for lspA dysfunction)

    • Apply pathway enrichment analysis to identify systematically affected cellular processes

    • Integrate with lipoprotein prediction algorithms to prioritize likely direct substrates

  • Validation and functional correlation:

    • Confirm lipoprotein processing defects using gel mobility shifts of selected targets

    • Correlate proteomic changes with phenotypic outcomes:

      • Growth rate and yield measurements

      • Substrate utilization patterns

      • Membrane integrity assessments

    • Perform targeted metabolomics to identify metabolic bottlenecks resulting from proteome alterations

This methodology builds on approaches successfully applied in the analysis of Dehalococcoides membrane proteins, where comparative proteomic studies revealed strain-specific protein expression patterns . The emPAI (exponentially modified protein abundance index) values used in previous studies provide a quantitative framework that can be extended to measure the effects of lspA manipulation .

How can divergent results between in vitro and in vivo studies of Dehalococcoides ethenogenes lspA be reconciled?

Reconciling divergent results between in vitro and in vivo studies of Dehalococcoides ethenogenes lspA requires a systematic analysis of multiple factors that influence enzyme behavior in different experimental contexts. The following methodological framework addresses this common research challenge:

  • Environmental parameter analysis:

    • Membrane composition effects: Reconstitute in vitro systems with lipid extracts from Dehalococcoides cultures to better mimic native environment

    • Redox conditions: Implement strictly controlled anaerobic conditions for in vitro studies matching the anaerobic growth requirements of Dehalococcoides

    • pH and ionic strength: Systematically vary these parameters in vitro to identify optimal conditions matching intracellular environment

  • Protein state comparison:

    • Post-translational modifications: Apply mass spectrometry to identify potential modifications present in vivo but absent in recombinant preparations

    • Oligomeric state analysis: Compare quaternary structure using techniques like native PAGE, SEC-MALS, or crosslinking studies

    • Conformation assessment: Use limited proteolysis or hydrogen-deuterium exchange to compare structural states

  • Interaction network mapping:

    • Pull-down assays to identify in vivo protein partners absent from in vitro studies

    • Proximity labeling (BioID or APEX) to map the in vivo neighborhood of lspA

    • Reconstitution experiments adding identified partners to in vitro assays

  • Substrate preprocessing assessment:

    • Substrate maturation: Investigate whether in vivo substrates undergo preprocessing steps before lspA recognition

    • Competition effects: Test whether preferential processing of certain substrates occurs in the complex cellular environment

    • Substrate delivery mechanisms: Explore if chaperones or other factors facilitate substrate engagement in vivo

This approach draws from principles applied in the study of Dehalococcoides proteins, where comparative analyses between pure cultures and mixed communities revealed both similarities and differences in protein detection patterns . For example, the linear relationship observed between protein detection in pure and mixed cultures for some proteins versus differential detection for others highlights the importance of environmental context .

What computational approaches can predict potential lipoprotein substrates of lspA in the Dehalococcoides ethenogenes genome?

Predicting potential lipoprotein substrates of lspA in the Dehalococcoides ethenogenes genome requires sophisticated bioinformatic approaches that integrate multiple predictive features. The following comprehensive methodology combines established algorithms with specialized techniques for Dehalococcoides:

  • Signal peptide and lipobox identification:

    • Apply specialized lipoprotein prediction tools:

      • LipoP: Statistical analysis of lipoproteins based on Hidden Markov Models

      • PRED-LIPO: Neural network-based lipoprotein predictor

      • LipPred: Support Vector Machine classifier for lipoprotein prediction

    • Implement consensus prediction using multiple algorithms to reduce false positives

    • Calibrate predictions using validated lipoproteins from related organisms

  • Genomic context analysis:

    • Examine gene neighborhoods for functional associations with membrane processes

    • Identify proteins co-regulated with known membrane components

    • Search for conserved lipoprotein operons across Dehalococcoides strains

  • Structural feature integration:

    • Predict transmembrane helices and topology using TMHMM or Phobius

    • Assess hydrophobic properties and membrane association potential

    • Model tertiary structures to evaluate spatial accessibility of lipoboxes

  • Comparative genomic approaches:

    • Perform cross-strain analysis to identify conserved lipoproteins in Dehalococcoides species

    • Implement phylogenetic profiling to associate predicted lipoproteins with specific metabolic functions

    • Compare with experimentally validated lipoproteins from related organisms

This prediction framework should be integrated with proteomic data available from Dehalococcoides studies. For example, the identification of S-layer proteins and other membrane-associated proteins in proteomic analyses provides candidates that can be retrospectively analyzed for lipoprotein features. The table below summarizes candidate lipoproteins identified in different Dehalococcoides strains based on proteomic studies and prediction criteria:

Protein ClassRepresentative in Strain 195Detected in ProteomicsLipobox Prediction ScorePotential Function
S-layer proteinDET1407High coverage (37%) HighCell envelope integrity
ABC transportersDET0419Moderate coverage (22%) HighSubstrate uptake
SPFH domain proteinDET0848Variable coverage (28-35%) ModerateMembrane organization
Hypothetical membrane proteinsDET0755Moderate coverage (21-31%) VariableUnknown functions

How should researchers address the challenges of lspA enzymatic assay inconsistency between biological replicates?

Addressing inconsistency in lspA enzymatic assays between biological replicates requires a systematic troubleshooting approach that identifies and controls key variables. The following comprehensive methodological framework targets the specific challenges of membrane protein enzymology:

  • Enzyme preparation standardization:

    • Implement rigorous quality control metrics:

      • SEC-MALS to confirm monodispersity and oligomeric state

      • Circular dichroism to verify consistent secondary structure

      • Thermal stability assays to ensure equivalent stability between preparations

    • Standardize detergent concentration using specific assays (e.g., sulfate-rhodamine for measurement of residual detergent)

    • Quantify active site concentration through titration with irreversible inhibitors

  • Substrate and reaction condition control:

    • Prepare larger batches of synthetic peptide substrates with comprehensive quality control

    • Control anaerobic conditions through oxygen scavengers and indicators

    • Implement internal standards and reference reactions in each experimental set

    • Monitor and standardize the lipid composition of assay environments

  • Advanced analytical approaches:

    • Apply progress curve analysis instead of single-timepoint measurements

    • Implement statistical process control charts to identify systematic variations

    • Perform replicate measurements across different enzyme preparations and substrate batches

    • Use factorial experimental design to identify interaction effects between variables

  • Decision tree for troubleshooting:

    • Systematic investigation of variable importance:

      • If variability correlates with enzyme batch → focus on expression/purification

      • If variability correlates with substrate batch → improve substrate quality control

      • If variability shows temporal patterns → investigate stability during storage

      • If variability associates with specific equipment → calibrate or replace instruments

This methodology incorporates principles from successful membrane protein studies, including the approaches used to analyze Dehalococcoides membrane proteins in different experimental contexts . The observation that some proteins showed consistent detection patterns across conditions while others varied highlights the importance of controlling experimental parameters when working with membrane-associated enzymes .

What controls and validation experiments are essential when studying the effect of site-directed mutations on lspA catalytic activity?

  • Expression and structural integrity controls:

    • Quantitative western blotting: Normalize activity to expression levels for each mutant

    • Circular dichroism spectroscopy: Confirm preservation of secondary structure

    • Thermal shift assays: Verify comparable stability between wild-type and mutant proteins

    • Size exclusion chromatography: Ensure consistent oligomeric state and monodispersity

  • Enzyme kinetics validation framework:

    • Complete kinetic characterization: Determine both kcat and KM parameters for each mutant

    • Multiple substrate testing: Assess effects across different substrate sequences to identify substrate-specific effects

    • pH-rate profiles: Map pH dependence to identify changes in ionizable catalytic residues

    • Temperature dependence: Calculate activation parameters (ΔH‡, ΔS‡) to detect mechanistic changes

  • Mechanistic probes and inhibitor studies:

    • Chemical rescue experiments: Attempt to restore activity in defective mutants with exogenous nucleophiles

    • Inhibitor sensitivity profiling: Compare inhibition patterns between wild-type and mutants

    • Solvent isotope effects: Measure activity in H2O vs. D2O to probe proton transfer steps

    • Thio-effect studies: Use thio-substituted substrates to probe transition state changes

  • Structural validation approaches:

    • Hydrogen-deuterium exchange mass spectrometry: Map conformational changes induced by mutations

    • Disulfide scanning: Introduce cysteine pairs to test predicted structural models

    • Computational modeling: Perform molecular dynamics simulations to predict structural perturbations

    • Complementary mutations: Test compensatory mutations that should restore activity if the structural model is correct

This framework builds upon approaches used in the study of other Dehalococcoides enzymes, where protein function has been studied across different experimental conditions . The application of multiple complementary techniques is particularly important for membrane proteins like lspA, where the membrane environment significantly influences protein behavior.

How can understanding lspA function in Dehalococcoides ethenogenes contribute to developing more efficient bioremediation strategies?

Understanding lipoprotein signal peptidase (lspA) function in Dehalococcoides ethenogenes can substantially enhance bioremediation strategies by providing insights into cellular mechanisms that underlie dehalogenation processes. The following methodological framework outlines how lspA research can translate to applied bioremediation technologies:

  • Mechanistic insights for bioaugmentation optimization:

    • Characterize how lspA processing affects the membrane localization of key dehalogenation enzymes

    • Identify lipoproteins involved in electron transport to reductive dehalogenases (RDases)

    • Determine if lspA activity represents a rate-limiting step in the assembly of functional dehalogenation machinery

    • Apply findings to optimize growth conditions for bioaugmentation cultures

  • Diagnostic applications for monitoring:

    • Develop antibodies or aptamers targeting specific lipoproteins processed by lspA as biomarkers

    • Design molecular probes for processed vs. unprocessed lipoproteins to assess metabolic activity

    • Implement RT-qPCR assays for lspA and associated lipoproteins alongside established RDase gene biomarkers like tceA, vcrA, and bvcA

    • Correlate lipoprotein processing patterns with dehalogenation activity in field samples

  • Genetic engineering approaches:

    • Modify lspA expression or substrate specificity to enhance processing of key dehalogenation-related lipoproteins

    • Engineer lipoproteins with optimized signal sequences for more efficient processing

    • Create synthetic consortia with complementary lipoprotein functionality for enhanced dehalogenation

    • Design genetic circuits linking lspA activity to environmental sensing for responsive bioremediation

  • Integration with systems biology models:

    • Incorporate lspA and lipoprotein dynamics into metabolic models of Dehalococcoides

    • Predict community-level interactions mediated by properly processed lipoproteins

    • Model the effects of environmental stressors on lipoprotein processing and membrane integrity

    • Simulate the impact of different electron donors on lipoprotein-dependent electron transport

This approach builds on established monitoring methods for Dehalococcoides in bioremediation sites, where quantification of specific RDase genes has provided insights into population dynamics and metabolic capabilities . The integration of lspA and lipoprotein processing into these monitoring frameworks would provide a more comprehensive understanding of the physiological state of Dehalococcoides populations during bioremediation.

What insights can comparative analysis of lspA across different Dehalococcoides strains provide about evolutionary adaptation to different chlorinated substrates?

Comparative analysis of lipoprotein signal peptidase (lspA) across Dehalococcoides strains offers profound insights into evolutionary adaptation to different chlorinated substrates. The following methodological framework outlines how such comparative studies can reveal functional specialization patterns:

  • Sequence-structure-function correlation:

    • Align lspA sequences from strains with different substrate preferences (e.g., 195, CBDB1, BAV1, VS, GT)

    • Map sequence variations to predicted structural elements and catalytic regions

    • Correlate specific sequence motifs with substrate utilization patterns

    • Implement ancestral sequence reconstruction to track evolutionary trajectories

  • Co-evolutionary network analysis:

    • Identify co-evolving lspA and lipoprotein substrate pairs across Dehalococcoides strains

    • Map how lspA sequence variations correlate with changes in the signal sequences of key lipoproteins

    • Analyze co-evolution between lspA and reductive dehalogenases specialized for different substrates

    • Detect evidence of horizontal gene transfer events that may have driven adaptation

  • Substrate specificity profiling:

    • Express recombinant lspA from different strains and test processing efficiency with signal peptides from strain-specific lipoproteins

    • Characterize substrate recognition patterns of lspA enzymes from strains with different chlorinated substrate preferences

    • Identify potential adaptations in substrate binding pockets that correlate with lipoprotein repertoire

    • Engineer chimeric lspA proteins to map specificity-determining regions

  • Integration with genome architecture and mobile genetic elements:

    • Analyze genomic context of lspA across strains to identify conserved vs. variable neighborhoods

    • Map relationships between lspA variants and the reductive dehalogenase homologous (rdh) gene clusters

    • Examine potential co-transfer of lspA variants with specific rdh genes on mobile genetic elements

    • Correlate lspA sequence types with other strain-specific adaptations

This comparative approach builds on observations from proteomic studies of Dehalococcoides strains, which revealed both conserved proteins and strain-specific expression patterns . For example, the detection of different RDases in different strains (TceA in strain 195, cbdbA1588 in CBDB1, RdhA14/VcrA in KB1 and SRNL cultures) demonstrates strain-specific functional adaptations that may extend to lipoprotein processing systems.

How might the development of specific inhibitors of Dehalococcoides ethenogenes lspA contribute to understanding its essentiality in dehalogenation processes?

Developing specific inhibitors of Dehalococcoides ethenogenes lipoprotein signal peptidase (lspA) would provide powerful chemical biology tools for dissecting its role in dehalogenation processes. The following comprehensive methodological framework outlines a path from inhibitor development to functional insights:

  • Rational inhibitor design strategy:

    • Structure-based approach: Utilize homology models based on crystal structures of lspA from other bacteria

    • Mechanism-based design: Develop transition state analogs targeting the unique catalytic mechanism of type II signal peptidases

    • Fragment-based screening: Identify building blocks with affinity for the active site

    • Natural product screening: Test known signal peptidase inhibitors from other systems

  • Inhibitor validation framework:

    • Biochemical assays: Determine inhibitory constants (Ki) and inhibition mechanisms

    • Target engagement: Confirm binding to lspA using thermal shift assays or isothermal titration calorimetry

    • Selectivity profiling: Assess activity against other proteases and peptidases

    • Cell permeability: Evaluate membrane penetration using liposome-based assays

  • Cellular effects assessment:

    • Dose-response studies: Correlate inhibitor concentration with:

      • Growth inhibition

      • Dehalogenation activity

      • Accumulation of unprocessed prolipoproteins

    • Proteome-wide impact: Use quantitative proteomics to map global effects on the membrane proteome

    • Electron microscopy: Examine changes in cell envelope ultrastructure

    • Membrane integrity assays: Test effects on membrane potential and permeability

  • Functional rescue experiments:

    • Substrate overexpression: Test if increasing levels of critical substrates overcomes inhibition

    • Modified substrates: Examine if engineered substrates that bypass lspA processing restore function

    • Complementation: Introduce inhibitor-resistant lspA variants to confirm specificity

    • Temporal control: Apply reversible inhibitors to determine recovery dynamics

This approach would complement genetic studies by allowing dose-dependent and temporal modulation of lspA activity. The methodology draws from principles applied in studying Dehalococcoides proteins, where comparative analyses have revealed functional relationships between different components of the dehalogenation machinery . The specific inhibition of lspA would provide insights into its role in processing lipoproteins that may be critical for the remarkable dehalogenation capabilities observed across Dehalococcoides strains.

What are the current knowledge gaps in understanding Dehalococcoides ethenogenes lspA and what future research directions should be prioritized?

Current knowledge of Dehalococcoides ethenogenes lipoprotein signal peptidase (lspA) contains significant gaps that limit our understanding of this enzyme's role in the unique physiology of these specialized bacteria. Analysis of existing research and the broader context of Dehalococcoides biology reveals several critical knowledge gaps and promising research directions.

The most fundamental gap is the lack of specific characterization of lspA from Dehalococcoides species. While proteomic studies have successfully identified numerous membrane proteins in these organisms , lspA itself has not been specifically isolated and characterized. This contrasts with the detailed characterization of reductive dehalogenases like TceA, PceA, and VcrA that have been studied extensively due to their direct involvement in dehalogenation reactions .

Priority research directions should include:

  • Fundamental characterization:

    • Express and purify recombinant lspA for biochemical and structural studies

    • Determine substrate specificity using synthetic peptides based on predicted Dehalococcoides lipoproteins

    • Establish structure-function relationships through mutagenesis and activity assays

    • Map the membrane topology and active site architecture

  • Physiological role investigation:

    • Identify the complete set of lspA substrates in Dehalococcoides using proteomics

    • Establish connections between lipoprotein processing and dehalogenation activity

    • Determine if lspA activity is regulated in response to different chlorinated substrates

    • Assess the essentiality of lspA under different growth conditions

  • Applied research extensions:

    • Develop specific inhibitors or activity modulators for manipulating lspA function

    • Engineer strains with modified lspA to enhance dehalogenation capabilities

    • Design diagnostic tools for monitoring lipoprotein processing as indicators of metabolic activity

    • Establish correlations between lspA variants and dehalogenation capabilities across strains

The integration of these research directions with existing knowledge of Dehalococcoides membrane biology, including the extensive proteomic data on membrane proteins and quantitative approaches for monitoring key functional genes , would significantly advance our understanding of these environmentally important organisms.

How might researchers overcome the challenges of working with the oxygen-sensitive Dehalococcoides ethenogenes to study lspA function in native conditions?

Studying lspA function in native conditions for the strictly anaerobic Dehalococcoides ethenogenes presents significant methodological challenges that require specialized approaches. The following comprehensive framework addresses these challenges and provides practical solutions for maintaining native conditions:

  • Advanced anaerobic cultivation systems:

    • Integrated anaerobic workstations: Implement fully contained systems with preset gas mixtures for consistent growth conditions

    • Continuous culture techniques: Develop chemostats with precise control of reducing conditions and substrate delivery

    • Microfluidic cultivation platforms: Design oxygen-impermeable systems for microscale experiments

    • Field sampling and preservation methods: Develop techniques for direct sampling from anaerobic environments with minimal oxygen exposure

  • Oxygen-free biochemical assay methodologies:

    • Sealed cuvette systems: Design spectrophotometric assays in custom anaerobic cuvettes

    • Enzyme-coupled oxygen scavenging systems: Implement glucose oxidase/catalase or alternative systems

    • Redox indicators: Include resazurin or methyl viologen to continuously monitor anaerobic conditions

    • Rapid-mixing stopped-flow devices: Perform kinetic measurements in oxygen-free environments

  • Structural biology adaptations:

    • Anaerobic crystallization chambers: Customize crystallization robots for operation in anaerobic gloveboxes

    • Cryo-protection protocols: Develop methods for transferring crystals to cryoprotectant without oxygen exposure

    • Anaerobic NMR systems: Implement oxygen-free sample handling for solution NMR studies

    • In situ structural approaches: Apply techniques like electron tomography directly to intact cells

  • Genetic system development:

    • Shuttle vector systems: Design plasmids that function in both E. coli and Dehalococcoides

    • Inducible promoters: Develop anaerobic-responsive genetic regulators

    • CRISPR-Cas9 adaptations: Optimize genome editing for anaerobic conditions

    • Reporter systems: Engineer oxygen-independent reporters (e.g., luciferase variants)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.