Recombinant Dehalococcoides ethenogenes Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rny; DET1608; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-527
Protein Length
full length protein
Species
Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) (Dehalococcoides ethenogenes (strain 195))
Target Names
rny
Target Protein Sequence
MLEFFMETAPTTTTGLPLSAILAIFFSFIIGIVFGGMALFVFRGFIMNRQLRIAQRKATK MLADSKVEAKDVLVEAKREADKARNSAEAELKERRSELAKQENRVMQKTEALDRKLENLE QREQSLTNREKSIDETQSQIEEIRTAELKRLEEVASMTTEQAKSSLLEMLEGEMQQETSR RLREWEIKIKAEADEKAREIVSQAIQRCASDVVTETTTNVVPLPSDEMKGRLIGREGRNI RALEQATGVDLIIDDTPEAVTISSFDPVRREIARQALSKLIIDGRIHPARIEEVVAKAKE EVEAAMIASGEQAAYQAGVHGLRPEIIKVMGRLKYRTSYGQNVLQHSIEVAQMSGMIGSE LGVNVTLARRAGFLHDIGKAVDRDVEGTHTQIGADMVKQWEKSPEVIKGVAEHHFDTPTV SIWGFIVSAADAISSARPGARRESLENYIKRLKALEEIADSFKGVEKSFAIQAGREVRIM VKPEEIDDLGAMRLARDIVKKIEDGLEYPGQIKVTVIRETRSVDFAK
Uniprot No.

Target Background

Function

Endoribonuclease initiating mRNA decay.

Database Links

KEGG: det:DET1608

STRING: 243164.DET1608

Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Dehalococcoides ethenogenes and why is it important for studying RNA processing enzymes?

Dehalococcoides ethenogenes strain 195 is the only known isolated organism capable of fully dechlorinating PCE and other chloroethenes to ethene through a respiratory process called dehalorespiration . Its genome annotation has revealed a compact 1.5-Mbp sequence with unique metabolic capabilities . The study of RNA processing enzymes such as Ribonuclease Y in this organism is particularly interesting because:

  • D. ethenogenes has highly specialized metabolism with at least 17 intact reductive dehalogenase (RDase) genes that require precise regulation

  • Understanding mRNA processing in this organism could reveal mechanisms coordinating the expression of these specialized enzymes

  • RNA decay and processing likely play critical roles in regulating the temporal expression of respiratory genes that have been shown to vary significantly during dechlorination cycles

What is known about Ribonuclease Y function in bacteria generally?

Ribonuclease Y (rny) is an endoribonuclease that initiates mRNA decay in many bacteria . While specific information about rny in Dehalococcoides is limited, general characteristics of bacterial rny include:

  • It belongs to the RNase Y family of proteins

  • In model organisms, it functions as a key enzyme initiating the decay of many mRNAs

  • The protein typically contains membrane-association domains and catalytic regions

  • In some bacteria, it forms part of an RNA degradosome complex that coordinates RNA processing

Understanding rny in D. ethenogenes would provide insights into how this specialized organism regulates its unique respiratory pathways through RNA processing mechanisms.

How do researchers identify potential RNA processing genes in the Dehalococcoides genome?

Researchers typically employ several approaches to identify and characterize RNA processing genes:

  • Genome analysis using sequence homology to known RNA processing enzymes

  • Transcriptomic studies to identify co-expression patterns

  • Comparative genomics across Dehalococcoides strains

For example, studies examining the temporal expression of genes in Dehalococcoides have revealed distinct expression patterns for respiratory genes . Similar approaches could be used to identify potential RNA processing enzymes like rny and their regulatory impacts.

The identification of RNA processing genes would build on existing genomic knowledge, where multiple Dehalococcoides strains have been characterized through 16S rRNA gene analysis as forming a unique phylogenetic cluster with three subgroups based on specific base substitution patterns .

What expression patterns have been observed for key genes in Dehalococcoides ethenogenes?

Research has demonstrated significant temporal variability in gene expression in Dehalococcoides. For reductive dehalogenase genes:

GeneExpression Level Relative to rpoB in PCE-Grown CellsExpression Level Relative to rpoB in 2,3-DCP-Grown Cells
tceASeveral-fold higher<1%
pceASeveral-fold higher10-fold higher than in PCE-grown cells
DET0162Several-fold higherSimilar to pceA (10-fold higher)
DET1559Approached rpoB levelsNot significantly expressed

This pattern of differential expression suggests sophisticated regulation of gene expression that likely involves RNA processing enzymes like Ribonuclease Y.

What are the challenges in expressing recombinant proteins from obligate anaerobes like Dehalococcoides ethenogenes?

Expressing recombinant proteins from Dehalococcoides presents several technical challenges:

  • Dehalococcoides grows slowly under strict anaerobic conditions, making native expression systems challenging

  • Its specialized metabolism may utilize rare codons or require specific cofactors

  • The organism has unique transcriptional regulators that may not function in conventional expression hosts

  • Membrane-associated proteins (like many RNA processing enzymes) often require specialized expression and purification approaches

A methodological approach to overcome these challenges typically involves:

  • Codon optimization for the expression host

  • Testing multiple expression systems (E. coli, yeast, cell-free systems)

  • Employing strictly controlled anaerobic conditions during protein purification

  • Using fusion tags that enhance solubility while maintaining enzymatic function

What purification strategies are most effective for functionally active recombinant RNA processing enzymes?

For purifying recombinant Ribonuclease Y from Dehalococcoides, researchers should consider:

  • Initial extraction under anaerobic conditions: Since Dehalococcoides is an obligate anaerobe, its proteins may be sensitive to oxidation.

  • Affinity chromatography options:

    • His-tagged purification under native conditions

    • GST-fusion systems for enhanced solubility

    • MBP-fusion for improved folding

  • Activity preservation measures:

    • Addition of reducing agents (DTT or β-mercaptoethanol)

    • Inclusion of metal cofactors if required

    • Stabilizing buffers that mimic cytoplasmic conditions

  • Activity verification:

    • RNA substrate cleavage assays

    • Coupled enzymatic assays

    • Fluorescence-based activity measurements

These approaches build upon methodologies used for characterizing other enzymes from Dehalococcoides, such as reductive dehalogenases .

How might Ribonuclease Y function regulate reductive dehalogenation gene expression?

Based on knowledge of reductive dehalogenase gene expression patterns in Dehalococcoides , Ribonuclease Y could potentially:

  • Regulate the differential expression of RDase genes in response to different chlorinated substrates

  • Control the temporal expression patterns of respiratory genes during dechlorination cycles

  • Coordinate the expression of accessory proteins required for reductive dehalogenase function

  • Modulate mRNA stability of key transcriptional regulators

For example, research has shown that in cells grown with PCE or TCE, transcript levels for tceA and pceA were several-fold higher than those for rpoB, while in cells grown with 2,3-DCP, tceA transcript levels were more than 2 orders of magnitude lower . Such dramatic differences in expression patterns suggest sophisticated post-transcriptional regulation.

What RNA sequencing methodologies are optimal for studying RNA processing in Dehalococcoides?

To effectively characterize RNA processing events mediated by Ribonuclease Y in Dehalococcoides, researchers should consider:

  • RNA extraction considerations:

    • Rapid sampling and flash-freezing to preserve RNA integrity

    • Anaerobic handling to prevent oxidative damage

    • RNA stabilization solutions specific for anaerobic bacteria

  • Sequencing approaches:

    • RNA-seq with specific library preparation methods to capture RNA 5' and 3' ends

    • Nanopore direct RNA sequencing for full-length transcript analysis

    • PARE (Parallel Analysis of RNA Ends) to identify cleavage sites

  • Bioinformatic analysis:

    • Differential expression analysis across growth conditions

    • Identification of RNA processing patterns and motifs

    • Integration with proteomics data to correlate RNA processing with protein levels

These methodologies would extend current approaches used to study gene expression in Dehalococcoides, where quantitative PCR has been effectively applied to monitor expression levels of reductive dehalogenase genes .

How do RNA decay mechanisms potentially impact the expression kinetics observed in Dehalococcoides respiratory genes?

Studies have demonstrated significant temporal variability in respiratory gene expression in Dehalococcoides during dechlorination cycles . RNA decay mechanisms mediated by enzymes like Ribonuclease Y could:

  • Create distinct temporal windows of gene expression through differential mRNA stability

  • Establish regulatory hierarchies by controlling mRNA half-lives

  • Coordinate the expression of genes required for each step in sequential dechlorination

  • Respond to environmental signals by targeting specific transcripts for degradation

This regulatory model is supported by observations that different reductive dehalogenase genes show distinct expression patterns when Dehalococcoides is grown on different substrates, with some transcripts persisting longer than others .

How might structural analysis of Dehalococcoides Ribonuclease Y inform its evolutionary adaptation to specialized metabolism?

Structural characterization of Dehalococcoides Ribonuclease Y would provide insights into:

  • Substrate specificity determinants:

    • RNA sequence motifs recognized by the enzyme

    • Structural features that distinguish it from other bacterial RNases

  • Evolutionary adaptations:

    • Potential modifications that support the specialized metabolism of Dehalococcoides

    • Conservation patterns across different Dehalococcoides strains

  • Functional domains:

    • Catalytic regions responsible for endoribonuclease activity

    • Potential interaction surfaces for association with other RNA processing factors

Such structural insights would complement current understanding of Dehalococcoides phylogeny, where 16S rRNA gene sequence analysis has identified three distinct subgroups within the Dehalococcoides cluster .

How could recombinant Ribonuclease Y from Dehalococcoides be utilized in RNA-based detection systems for environmental monitoring?

Recombinant Ribonuclease Y with characterized sequence specificity could potentially be used to develop:

  • Biosensors for environmental monitoring:

    • RNA-based detection systems for specific contaminants

    • Field-deployable kits for rapid assessment of dechlorination potential

  • Diagnostic tools for bioremediation assessment:

    • Analysis of RNA processing patterns as indicators of active dechlorination

    • Correlation of RNA profiles with remediation progress

These applications would build on current molecular monitoring approaches, where quantitative PCR targeting 16S rRNA and reductive dehalogenase genes has proven effective for tracking Dehalococcoides populations during bioremediation .

What insights could comparative analysis of RNA processing across different Dehalococcoides strains provide?

Multiple Dehalococcoides strains have been isolated or characterized in enrichment cultures, each with distinct reductive dehalogenase gene complements and dechlorination capabilities . Comparative analysis of RNA processing across these strains could reveal:

  • Regulatory adaptations that support different dechlorination capabilities

  • Conserved RNA processing mechanisms essential to the Dehalococcoides lifestyle

  • Strain-specific RNA regulatory elements that correlate with substrate preferences

For example, research has shown that different Dehalococcoides strains contain different complements of the reductive dehalogenase genes tceA, vcrA, and bvcA, with distinct expression patterns . Understanding how RNA processing contributes to these differences would advance our understanding of the ecological roles of different Dehalococcoides strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.