Recombinant Dehalococcoides sp. Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Genetic and Functional Context in Dehalococcoides

Dehalococcoides genomes encode cobamide salvage genes (e.g., cobT, cobU, cobC, cobS) but lack biosynthesis genes like cobD . Key findings include:

  • Salvage Pathway Activation: Dehalococcoides upregulates genes for cobamide transport (e.g., btuFCD) and remodeling under cobalamin-deficient conditions .

  • Remodeling Mechanism: The organism modifies cobamide lower ligands (e.g., adenine, 5-OHBza) into functional cobalamin using enzymes like CobT (phosphoribosyltransferase) and CobU (adenosylcobinamide-phosphate guanylyltransferase) .

  • DMB Dependency: Lower ligand remodeling requires 5,6-dimethylbenzimidazole (DMB) for guided cobalamin synthesis, a process absent in Dehalococcoides but enabled by co-cultured microbes .

Comparative Genomic Analysis

Gene/FunctionDehalococcoides PresenceRole in Cobalamin Metabolism
cobD (biosynthesis)Absent Not applicable (auxotrophic)
cobT (salvage)Present Lower ligand remodeling
btuFCD (transport)Present Cobamide uptake
cobU (salvage)Present Adenosylcobinamide modification

Key Research Findings

  • Interspecies Cobamide Transfer: Co-cultures with Geobacter lovleyi or Methanosarcina barkeri enable Dehalococcoides to acquire cobalamin precursors, bypassing the need for cobD .

  • Proteomic Evidence: High expression of salvage proteins (e.g., CobT, BtuFCD) in Dehalococcoides during dechlorination confirms reliance on exogenous cobamides .

  • Energetic Trade-offs: Remodeling non-cobalamin cobamides is energy-intensive, making direct cobalamin uptake more efficient .

Implications for Bioremediation

The absence of cobD underscores Dehalococcoides’ dependence on microbial partnerships for cobalamin. Strategies to enhance bioremediation include:

  • DMB Supplementation: Enables guided cobalamin synthesis from environmental cobamides .

  • Co-culture Engineering: Pairing Dehalococcoides with cobalamin-producing bacteria (e.g., Geobacter) improves dechlorination rates .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point for your preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development for your protein.
Synonyms
cobD; cbdbA638; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Dehalococcoides mccartyi (strain CBDB1)
Target Names
cobD
Target Protein Sequence
MEILLIFLLALVIDMVFGDPPNAFHPVAYMGKVISLFERAGFKGGKGYQFVYGIVMVIFT MALFFVPVYFLLDWLQGINSIVYIIVSAILFKMCFTVTGLRKAALLIKRLLEKDDIAQAR FELRSLVSRDTSKLPQPKLVAAAVESVAESIGDGFVAPLFFFLIFGVPGVMAYRVVSTFD SMVGYRGKYEYLGKFAARFDDVLNFIPARLSALCILVASFFGRYSPAGAWRIMWRDHGKT QSPNAGWPMATAAGALEVCLEKVGHYSLGDDIRPLLPQTISCSLVLINNAGCIWVLISVG VIYFARIA
Uniprot No.

Target Background

Function
CobD catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group.
Database Links

KEGG: deh:cbdbA638

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of CobD in Dehalococcoides sp.?

CobD (cobalamin biosynthesis protein D) is an essential enzyme in the vitamin B12 (cobalamin) biosynthesis pathway in Dehalococcoides species. It specifically functions as a crucial component in the anaerobic cobalamin biosynthetic pathway, catalyzing the conversion of adenosylcobinamide phosphate to adenosylcobinamide-GDP, which is an intermediate step in the complete synthesis of cobalamin . This function is particularly significant because Dehalococcoides mccartyi strains are corrinoid-auxotrophic bacteria, meaning they require external sources of vitamin B12 or its precursors to conserve energy via organohalide respiration .

Why is the study of CobD protein important for Dehalococcoides research?

The study of CobD protein is crucial because Dehalococcoides mccartyi strains depend on cobalamin for survival and metabolic function. These bacteria have evolved highly specialized metabolic pathways that utilize cobalamin-dependent reductive dehalogenases to detoxify chlorinated compounds. Research has demonstrated that cultures of D. mccartyi strains grown with limiting amounts of vitamin B12 (1 μg/L) quickly depleted the available cobalamin, resulting in incomplete dechlorination of polychlorinated ethenes and accumulation of vinyl chloride . In contrast, cultures supplemented with higher concentrations (25 μg/L) exhibited up to 2.3-fold higher dechlorination rates and 2.8–9.1-fold increased growth yields . Understanding CobD function provides insights into cobalamin metabolism and potentially enables optimization of bioremediation applications utilizing these organisms.

What growth conditions are optimal for expressing recombinant CobD from Dehalococcoides sp.?

The expression of recombinant CobD from Dehalococcoides species requires careful consideration of the organism's natural growth parameters. Based on studies of Dehalococcoides isolates, optimal expression conditions should maintain:

  • Strict anaerobic conditions with redox potentials below -110 mV

  • pH range between 6.9-7.5

  • Mesophilic temperature range

  • Appropriate reductants such as titanium(III) complexed with citrate or nitrilotriacetate, or a combination of sodium sulfide (0.2–0.5 mM), L-cysteine (0.2 mM), and DL-dithiothreitol (0.5–1 mM)

For heterologous expression systems, these parameters should be adapted to the host organism while maintaining protein functionality. Medium compositions may need modification to include specific sulfur compounds, as studies show that Dehalococcoides strains require sulfur for growth .

What purification strategies are most effective for recombinant CobD protein?

Purification of recombinant CobD protein presents specific challenges due to the anaerobic nature of Dehalococcoides and potential oxygen sensitivity of the protein. An effective purification strategy typically involves:

  • Initial Expression Optimization: Use of expression vectors with tightly regulated promoters (e.g., arabinose-regulated systems similar to those used for cbdbA1625 gene expression)

  • Anaerobic Purification Protocol:

    • All purification steps performed in an anaerobic chamber

    • Buffer systems containing appropriate reductants (e.g., 1 mM Na₂S or 1 mM titanium(III))

    • Temperature control maintained at 20-25°C throughout purification

  • Chromatography Sequence:

    • Initial capture using affinity chromatography (His-tag or specific substrate-based affinity)

    • Intermediate purification via ion exchange chromatography

    • Final polishing using size exclusion chromatography under anaerobic conditions

  • Quality Assessment:

    • SDS-PAGE analysis for purity

    • Activity assays to confirm functional state

    • Mass spectrometry for identity confirmation

The purification process should incorporate steps to minimize protein denaturation, particularly maintaining anaerobic conditions throughout, as exposure to oxygen has been shown to negatively impact the viability and function of proteins from Dehalococcoides species .

How can researchers effectively validate the functionality of purified recombinant CobD?

Validating the functionality of purified recombinant CobD requires multiple complementary approaches:

  • Enzymatic Activity Assay: Measure the conversion of adenosylcobinamide phosphate to adenosylcobinamide-GDP using HPLC or LC-MS techniques.

  • Complementation Studies: Use CobD-deficient bacterial strains to test whether the purified protein can restore cobalamin biosynthesis pathway function.

  • Co-culture Validation: Implement co-culture experiments similar to those conducted with D. mccartyi strains and corrinoid-producing organisms like Methanosarcina barkeri or Sporomusa species . The addition of functional CobD should enhance cobalamin biosynthesis in appropriate contexts.

  • Structural Analysis: Circular dichroism spectroscopy to confirm proper protein folding.

  • Binding Assays: Use isothermal titration calorimetry or surface plasmon resonance to verify substrate binding.

A functional validation protocol might follow this sequence:

Validation StepMethodologyExpected OutcomeInterpretation
Substrate BindingIsothermal Titration CalorimetryKd < 10 μMActive binding site
Enzymatic ActivityHPLC-based assay>70% conversion of substrateFunctional catalytic activity
Thermal StabilityDifferential Scanning FluorimetryTm > 45°CProperly folded protein
In vitro ComplementationReconstitution assay with pathway enzymesRestoration of pathway activityFunctional in biochemical context

What analytical methods are recommended for detecting CobD-mediated cobalamin production?

Detection of CobD-mediated cobalamin production requires sensitive and specific analytical methods. Recommended approaches include:

  • Microbiological Assay: Similar to methods used for detecting CN-Cbl in Dehalococcoides cultures, utilizing indicator organisms like Lactobacillus delbrueckii ATCC 7830 . This assay can detect cobalamin concentrations as low as 5 ng/L.

  • HPLC Analysis: High-performance liquid chromatography coupled with:

    • UV-Vis detection (350-370 nm for cobalamin)

    • Fluorescence detection after derivatization

    • Mass spectrometry for structural confirmation

  • LC-MS/MS Analysis: For identification and quantification of specific cobalamin forms and intermediates. This method provides higher specificity and sensitivity than HPLC alone.

  • Radioisotope Tracing: Using ⁶⁰Co-labeled precursors to track cobalamin synthesis in reconstituted systems containing CobD.

The sensitivity ranges for these methods are:

Analytical MethodDetection LimitAdvantagesLimitations
Microbiological Assay2-5 ng/LHigh sensitivity, bioavailability assessmentLower specificity, time-consuming
HPLC-UV20-50 ng/LGood specificity, robustModerate sensitivity
HPLC-Fluorescence5-10 ng/LImproved sensitivityRequires derivatization
LC-MS/MS0.1-1 ng/LHighest specificity and sensitivityEquipment cost, complex method development

How does CobD from Dehalococcoides sp. interact with other proteins in the cobalamin biosynthesis pathway?

CobD functions within a complex network of enzymes in the anaerobic cobalamin biosynthesis pathway. Its interactions with other pathway proteins are critical for efficient vitamin B12 production. Research suggests that CobD likely forms transient complexes with:

  • Upstream Enzymes: Those producing adenosylcobinamide phosphate

  • Downstream Enzymes: Those utilizing adenosylcobinamide-GDP

  • Potential Scaffold Proteins: That may spatially organize the pathway enzymes

The interaction network is particularly important in the context of guided cobalamin biosynthesis, where the presence of lower pathway enzymes and specific benzimidazole bases (like 5′,6′-dimethylbenzimidazole, DMB) directs the synthesis toward specific cobalamin forms. In experiments with D. mccartyi co-cultures amended with 10 μM DMB, guided biosynthesis generated cobalamin forms that supported Dehalococcoides activity and growth, demonstrating the importance of these pathway interactions .

Future research could employ techniques such as:

  • Protein-protein interaction studies using pull-down assays

  • Crosslinking mass spectrometry

  • Cryo-electron microscopy of pathway complexes

  • Förster resonance energy transfer (FRET) analysis of labeled pathway components

What are the mechanistic differences between CobD from Dehalococcoides sp. and CobD homologs from other bacteria?

Comparative analysis of CobD from Dehalococcoides sp. with homologs from other bacteria reveals several mechanistic differences that reflect the specialized metabolism of these organohalide-respiring bacteria:

  • Cofactor Requirements: Dehalococcoides CobD may have adapted to function under the strictly anaerobic, low-redox potential conditions required by these organisms (below -110 mV) .

  • Substrate Specificity: The substrate binding pocket of Dehalococcoides CobD likely exhibits structural adaptations that optimize it for specific corrinoid intermediates relevant to the organism's ecological niche.

  • Catalytic Efficiency: Given the limited energy conservation mechanisms in Dehalococcoides (strictly organohalide respiration with no other respiratory or fermentative pathways) , their CobD may have evolved enhanced catalytic efficiency compared to homologs from metabolically versatile bacteria.

  • Regulatory Interactions: Unique regulatory mechanisms may exist that coordinate CobD activity with the expression of reductive dehalogenase genes (rdhA), similar to the observed coordination between dehalogenation activity and other cellular processes in these organisms .

  • Structural Stability: The protein likely exhibits adaptations for stability under the specific growth conditions of Dehalococcoides, including mesophilic temperatures and pH 6.9-7.5 .

A detailed structural comparison would be valuable for future research, potentially revealing adaptations that could inform protein engineering approaches for enhanced cobalamin biosynthesis.

What strategies can overcome the corrinoid auxotrophy of Dehalococcoides species in bioremediation applications?

Addressing the corrinoid auxotrophy of Dehalococcoides species is critical for enhancing their bioremediation capabilities. Research-based strategies include:

  • Guided Corrinoid Biosynthesis: Supplementing Dehalococcoides-containing environments with specific lower ligand bases like 5′,6′-dimethylbenzimidazole (DMB). Research has shown that this approach enables guided biosynthesis and generates cobalamin forms that support Dehalococcoides activity even when the co-occurring microorganisms (like methanogens and acetogens) don't naturally produce cobalamin .

  • Optimized Co-culture Systems: Developing defined microbial consortia that pair Dehalococcoides with efficient corrinoid producers. Experimental co-cultures with specific methanogenic Archaea and acetogenic Bacteria have demonstrated interspecies cobamide transfer .

  • Genetic Engineering Approaches:

    • Heterologous expression of key cobalamin biosynthesis genes in Dehalococcoides

    • Engineering of synthetic cobalamin transport systems

    • Modification of reductive dehalogenases to function with alternative corrinoids

  • Bioaugmentation Formulations: Developing specialized formulations that include both Dehalococcoides strains and optimal concentrations of vitamin B12 or precursors.

The effectiveness of these strategies in experimental settings is summarized below:

StrategyExperimental OutcomePotential Field Application
DMB Supplementation (10 μM)Enhanced dechlorination activity in co-culturesDirect injection at contaminated sites
Defined Co-culturesInterspecies corrinoid transfer demonstratedSpecialized bioaugmentation cultures
Direct Vitamin B12 Amendment (25 μg/L)2.3× higher dechlorination rates, 2.8–9.1× increased growth yieldsCost-effective amendment protocol

How does the unique cell morphology of Dehalococcoides affect experimental approaches to studying CobD?

The distinctive disc-shaped morphology of Dehalococcoides cells, measuring approximately 1 μm wide and only 0.1-0.2 μm thick with characteristic biconcave indentations , presents significant challenges for conventional laboratory techniques. These morphological features influence experimental approaches to studying CobD in several ways:

  • Biomass Limitations: The extremely low biomass yield (approximately 1 mg wet weight from 100 ml culture) restricts the amount of native protein available for study, necessitating recombinant expression systems.

  • Microscopy Challenges: The thin disc morphology makes these cells difficult to visualize using phase-contrast microscopy, requiring advanced electron microscopy techniques for detailed morphological studies .

  • Protein Localization Studies: Conventional fluorescence microscopy approaches for protein localization are complicated by the unusual cell architecture, potentially requiring super-resolution microscopy techniques.

  • Cell Fractionation Difficulties: The unique cell wall structure, which differs from both Gram-positive and Gram-negative bacteria, complicates standard cell fractionation protocols used to study protein compartmentalization.

  • Cultivation Challenges: The strict anaerobic nature and sensitivity to redox potential (inactive above -110 mV) require specialized cultivation techniques for studying native CobD expression and function.

Researchers should consider these morphological constraints when designing experiments, potentially adapting protocols to accommodate the unique cellular architecture of Dehalococcoides species.

What are the challenges in resolving the three-dimensional structure of CobD from Dehalococcoides sp.?

Determining the three-dimensional structure of CobD from Dehalococcoides sp. presents several significant challenges:

  • Expression and Purification Barriers:

    • Difficulty in obtaining sufficient quantities of soluble, properly folded protein

    • Potential oxygen sensitivity requiring anaerobic purification techniques

    • Limited biomass from native sources (~1 mg wet weight from 100 ml culture)

  • Crystallization Challenges:

    • Potential conformational heterogeneity affecting crystal formation

    • Requirement for anaerobic crystallization conditions

    • Need for specialized crystallization screens that maintain reducing conditions

  • Methodological Considerations:

    • X-ray crystallography: Challenges in obtaining diffraction-quality crystals

    • Cryo-EM: Size limitations (CobD may be too small for single-particle analysis)

    • NMR spectroscopy: Isotopic labeling requirements and size limitations

  • Computational Approaches:

    • Limited homologous structures as templates for accurate modeling

    • Uncertainty in predicting ligand binding sites and catalytic residues

Researchers might consider hybrid approaches combining partial structural data with computational modeling, or exploring the use of AlphaFold2 and similar AI-based prediction tools as starting points for structural characterization.

How can researchers optimize culture conditions to enhance recombinant CobD expression while maintaining protein functionality?

Optimizing culture conditions for recombinant CobD expression requires balancing maximum protein production with maintenance of functional integrity. Based on the known properties of Dehalococcoides and its proteins, the following optimization strategies are recommended:

  • Host Selection: Choose expression hosts capable of:

    • Anaerobic or microaerobic growth

    • Supporting reducing conditions

    • Post-translational modifications if needed for CobD function

  • Expression System Design:

    • Use tightly regulated promoters to control expression timing

    • Incorporate solubility-enhancing fusion partners

    • Consider codon optimization based on Dehalococcoides codon usage patterns

  • Culture Condition Optimization:

    • Maintain reducing conditions throughout cultivation (e.g., with titanium(III) citrate)

    • Control pH within 6.9-7.5 range

    • Consider temperature modulation (reduced temperature often enhances proper folding)

  • Supplementation Strategy:

    • Add potential cofactors or substrates that might stabilize the protein

    • Include chemical chaperones to promote proper folding

    • Supply sulfur compounds that might be required for protein stability

  • Expression Protocol:

    • Implement fed-batch cultivation to reduce metabolic burden

    • Optimize induction timing based on growth phase

    • Develop anaerobic harvesting and protein extraction protocols

ParameterOptimization RangeMonitoring MethodExpected Impact
Redox Potential< -110 mVRedox electrodeMaintains proper protein folding
pH6.9-7.5Continuous monitoringReflects natural environment of protein
Temperature18-30°CControlled incubationBalance between expression and folding
Induction TimingMid-log phaseGrowth curve analysisOptimal cellular resources for expression
Media SupplementsSulfur compounds, reductantsChemical analysisProvides essential components for stability

How does CobD function vary across different Dehalococcoides strains?

Comparative analysis reveals subtle but significant variations in CobD function across Dehalococcoides strains, reflecting their evolutionary adaptations to specific ecological niches and substrate preferences:

  • Strain-Specific Adaptations: Different Dehalococcoides strains (e.g., 195T, CBDB1, BAV1, GT, VS) show variations in their organohalide respiration capabilities , suggesting potential corresponding differences in cobalamin utilization and possibly CobD function.

  • Substrate Preference Correlation: Strains with different reductive dehalogenase profiles may exhibit variations in CobD activity that correlate with their preferred chlorinated substrates. For example, strain BAV1 can grow with vinyl chloride as an electron acceptor, while strain CBDB1 cannot .

  • Phylogenetic Considerations: All characterized Dehalococcoides strains form a monophyletic group with 16S rRNA gene sequence identities of ≥98% , suggesting that CobD proteins likely share core functional characteristics while potentially exhibiting strain-specific optimizations.

  • Cobalamin Requirements: Studies have shown that Dehalococcoides strains have different growth yields and doubling times (ranging from 0.8 to 3 days) , which may reflect variations in cobalamin metabolism efficiency, including potential differences in CobD activity.

  • Genomic Context Analysis: Comparative genome analysis has revealed differences in gene neighborhood patterns around cobalamin-related genes in different strains, potentially indicating variations in regulation or pathway organization.

These variations highlight the importance of strain selection when studying CobD function and suggest that a comprehensive understanding requires examination across multiple Dehalococcoides representatives.

What methodological approaches are most effective for studying CobD interactions with reductive dehalogenase systems?

Investigating the interactions between CobD (involved in cobalamin biosynthesis) and reductive dehalogenase systems requires sophisticated methodological approaches that can capture these complex relationships:

  • Transcriptomic Correlation Analysis:

    • RNA-Seq to examine coordinated expression patterns between cobD and rdh genes

    • qPCR approaches similar to those used for rdh gene studies adapted for cobD

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation using antibodies against CobD to identify associated proteins

    • Bacterial two-hybrid assays adapted for anaerobic conditions

    • Crosslinking mass spectrometry to identify transient interactions

  • Functional Correlation Experiments:

    • Cobalamin limitation studies examining effects on rdh gene expression and activity

    • Guided cobalamin biosynthesis experiments with DMB supplementation

    • CobD inhibition studies measuring impacts on reductive dehalogenation rates

  • Genetic Manipulation Approaches:

    • Heterologous expression systems similar to those used for rdh promoter-lacZ fusions

    • CRISPR-Cas9 based mutagenesis (if developed for Dehalococcoides)

    • Complementation studies with CobD variants

  • Structural Biology Techniques:

    • Cryo-electron tomography of intact cells to visualize spatial relationships

    • High-resolution microscopy with immunogold labeling

    • Computational docking and molecular dynamics simulations

The most promising approach would be integrating transcriptomic data with protein interaction studies, potentially revealing how cobalamin metabolism (via CobD) is coordinated with reductive dehalogenase expression and activity.

How can comparative genomics inform the evolution of cobalamin biosynthesis pathways in Dehalococcoides and related organohalide-respiring bacteria?

Comparative genomics provides powerful insights into the evolution of cobalamin biosynthesis pathways in Dehalococcoides and related bacteria:

  • Phylogenetic Analysis of Biosynthetic Genes:

    • Reconstructing the evolutionary history of CobD and related genes across the Chloroflexi phylum

    • Identifying potential horizontal gene transfer events that shaped pathway evolution

    • Examining selective pressures on cobalamin biosynthesis genes

  • Genome Architecture Analysis:

    • Studying synteny and gene neighborhood conservation around cobD

    • Identifying potential operonic structures and their conservation

    • Examining mobile genetic element associations that might indicate horizontal acquisition

  • Regulatory Element Identification:

    • Comparative analysis of promoter regions similar to the approach used for rdh genes

    • Identification of conserved regulatory motifs potentially binding transcriptional regulators

    • Examination of potential cross-regulation between cobalamin biosynthesis and rdh genes

  • Metabolic Reconstruction and Pathway Completeness:

    • Assessing the presence/absence of complete cobalamin biosynthetic pathways across strains

    • Identifying potential pathway variations and alternative routes

    • Correlating pathway completeness with ecological niche and substrate utilization

  • Pan-genome Analysis:

    • Determining core versus accessory genes related to cobalamin metabolism

    • Identifying strain-specific adaptations in the pathway

    • Correlating genomic content with phenotypic variation in cobalamin requirements

These approaches collectively illustrate how Dehalococcoides species evolved their specialized corrinoid-auxotrophic lifestyle while maintaining the ability to guide cobalamin biosynthesis when provided with appropriate precursors.

How can recombinant CobD be utilized to enhance bioremediation of chlorinated compounds?

Recombinant CobD offers several strategic applications for enhancing bioremediation of chlorinated compounds, particularly in addressing the cobalamin limitation that often constrains Dehalococcoides performance:

  • Engineered Bioaugmentation Consortia:

    • Development of specialized microbial consortia containing both Dehalococcoides and bacteria expressing recombinant CobD to enhance in situ cobalamin production

    • Design of synthetic microbial communities with optimized cobalamin transfer capabilities

  • Enzyme-Based Amendment Strategies:

    • Direct application of purified recombinant CobD along with pathway precursors and other biosynthetic enzymes to contaminated sites

    • Development of enzyme immobilization techniques for sustained release of CobD at contaminated sites

  • Genetic Engineering Applications:

    • Creation of enhanced Dehalococcoides strains or partner organisms with optimized cobD expression

    • Development of genetic circuits linking cobD expression to detection of chlorinated compounds

  • Bioprocess Optimization:

    • Design of ex situ bioreactors with optimized cobalamin production via recombinant CobD

    • Two-stage treatment processes separating cobalamin generation from dechlorination processes

Research has shown that addressing cobalamin limitations can dramatically improve dechlorination performance, with properly supplemented cultures exhibiting up to 2.3-fold higher dechlorination rates and 2.8–9.1-fold increased growth yields compared to cobalamin-limited conditions .

What analytical techniques are most suitable for monitoring CobD-mediated processes in complex environmental samples?

Monitoring CobD-mediated processes in complex environmental matrices requires specialized analytical approaches that can detect specific biomarkers and metabolic indicators:

  • Molecular Biological Techniques:

    • RT-qPCR targeting cobD mRNA expression, similar to approaches used for rdh gene expression studies

    • Metatranscriptomic analysis to monitor cobD expression patterns in mixed communities

    • Digital droplet PCR for absolute quantification in samples with PCR inhibitors

  • Advanced Mass Spectrometry:

    • Targeted LC-MS/MS methods for detecting specific cobalamin intermediates

    • Metaproteomics to track CobD protein abundance in environmental samples

    • Stable isotope probing combined with proteomics to track newly synthesized CobD

  • Bioreporter Systems:

    • Development of fluorescent or luminescent reporters linked to cobD promoters

    • Whole-cell biosensors designed to respond to cobalamin availability

  • Spectroscopic Techniques:

    • Specialized spectroscopic methods adapted for detecting corrinoid compounds in environmental matrices

    • Field-deployable spectroscopic tools for rapid assessment

  • Integrated Multi-omics Approaches:

    • Combining metagenomics, metatranscriptomics, and metaproteomics for comprehensive pathway monitoring

    • Correlation analysis between cobD expression and dechlorination activity

TechniqueDetection LimitAdvantagesChallenges in Environmental Samples
RT-qPCR10^2-10^3 copies/gHigh specificity, quantitativePCR inhibitors, RNA degradation
LC-MS/MSng/L rangeDirect metabolite detectionMatrix effects, recovery efficiency
Metaproteomicsμg/L rangeDirect protein detectionProtein extraction efficiency, complexity
BioreportersVariableReal-time monitoring potentialDeployment challenges, specificity
MetatranscriptomicsVariableComprehensive pathway viewCost, bioinformatic complexity

What are the key considerations for scaling up recombinant CobD production for research applications?

Scaling up recombinant CobD production for research applications requires careful consideration of multiple factors to maintain protein quality while achieving adequate yields:

  • Expression System Selection:

    • Evaluation of heterologous hosts based on growth characteristics, protein folding capacity, and compatibility with anaerobic cultivation

    • Consideration of inducible versus constitutive expression systems

    • Assessment of codon optimization requirements based on expression host

  • Bioreactor Design and Operation:

    • Implementation of precisely controlled anaerobic cultivation systems

    • Maintenance of reducing conditions with redox potential below -110 mV

    • Design of fed-batch or continuous cultivation strategies to optimize biomass and protein yields

  • Scaling Considerations:

    • Development of scale-appropriate mixing strategies that minimize shear stress

    • Implementation of inline monitoring for critical parameters (pH, redox potential, dissolved gases)

    • Design of harvest and downstream processing strategies compatible with larger volumes

  • Purification Process Development:

    • Design of scalable chromatography methods maintainable under anaerobic conditions

    • Development of high-capacity affinity resins specific for CobD

    • Implementation of automated systems to maintain anaerobic integrity throughout purification

  • Quality Control Strategies:

    • Implementation of analytical methods to assess protein quality at various scales

    • Development of activity assays adaptable to high-throughput screening

    • Establishment of stability testing protocols for different storage conditions

  • Regulatory and Safety Considerations:

    • Assessment of biosafety requirements for working with recombinant proteins

    • Development of containment strategies for large-scale anaerobic cultivations

    • Consideration of waste management and disposal protocols

These considerations address the unique challenges associated with CobD production, particularly the requirements for anaerobic conditions and specialized cultivation techniques reflective of Dehalococcoides' natural growth parameters .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.