Recombinant Dehalococcoides sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dehalococcoides sp. Large-Conductance Mechanosensitive Channel (mscL)

Recombinant Dehalococcoides sp. Large-conductance mechanosensitive channel (mscL) is a protein derived from the Dehalococcoides genus, which is known for its role in the reductive dechlorination of halogenated organic compounds. This channel protein is significant due to its involvement in cellular responses to mechanical stress, which is crucial for the survival of bacteria in fluctuating environmental conditions.

Characteristics of Dehalococcoides spp.

Dehalococcoides species, particularly Dehalococcoides mccartyi, are anaerobic bacteria that play a pivotal role in bioremediation by degrading toxic chlorinated solvents such as tetrachloroethene (PCE) and trichloroethene (TCE). These bacteria utilize hydrogen as an electron donor and exhibit diverse metabolic pathways that allow them to adapt to various environmental conditions.

Morphological and Physiological Traits

  • Cell Structure: Dehalococcoides spp. have unique cell wall structures that differ from typical Gram-negative bacteria, lacking a peptidoglycan layer and instead exhibiting S-layer characteristics.

  • Growth Conditions: Optimal growth occurs in anaerobic environments with specific pH and temperature ranges. The growth is enhanced by the presence of certain vitamins and electron acceptors.

TraitDescription
Cell Size0.3–1 mm diameter, 0.1–0.2 mm thick
Optimal pH6.5 - 8.0
Optimal Temperature25 - 30°C
Electron DonorHydrogen
Electron AcceptorsChlorinated compounds

Function and Importance of mscL

The large-conductance mechanosensitive channel (mscL) is essential for bacterial survival under osmotic stress conditions. It allows for the rapid release of solutes from the cell in response to mechanical stimuli, thereby preventing cell lysis.

Protein Structure and Function

The mscL protein consists of multiple transmembrane segments that form a pore through which ions and small molecules can pass when the membrane tension exceeds a certain threshold. This mechanism is vital for maintaining osmotic balance within the cell.

  • Gene Information:

    • Gene Name: mscL

    • Ordered Locus Name: DehaBAV1_1197

    • Protein Length: 154 amino acids

Research Findings on Recombinant mscL

Recent studies have focused on characterizing the recombinant form of the mscL protein from Dehalococcoides sp., particularly strain BAV1, which has been shown to retain functional properties similar to its native counterpart.

Expression and Purification

Recombinant mscL has been successfully expressed in various systems, allowing for detailed studies on its biophysical properties and functionality under different environmental conditions.

  • Expression System: Typically expressed in E. coli.

  • Purification Method: Affinity chromatography followed by size exclusion chromatography.

Applications in Bioremediation

The understanding of mscL's function can enhance bioremediation strategies by improving the survival rates of Dehalococcoides spp. under stress conditions encountered during the degradation of chlorinated compounds.

Potential Biomarker

Dehalococcoides spp., including those expressing mscL, can serve as biomarkers for monitoring organohalide contamination in various environments, providing insights into bioremediation efficiency.

References

  1. Duhamel et al., "Long term survival of Dehalococcoides mccartyi strains," Biorxiv, 2022.

  2. Löffler et al., "Dehalococcoides mccartyi gen. nov., sp. nov.", Enviro Wiki, 2013.

  3. American Scientific, "ELISA Recombinant Dehalococcoides sp.", American Sci, accessed March 2025.

  4. Griffin et al., "Isolation and Characterization of Dehalococcoides sp.", PubMed Central, 2009.

  5. Tomás et al., "Dehalococcoides as a Potential Biomarker," Frontiers in Microbiology, 2017.

  6. Kittelmann et al., "Comparative proteomics of Dehalococcoides spp.", PubMed, 2012.

  7. Core Research, "Dehalococcoides spp. in River Sediments", CORE, accessed March 2025.

  8. Schumacher et al., "Organohalide Respiring Bacteria," Frontiers in Microbiology, accessed March 2025.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; DehaBAV1_1197; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Target Names
mscL
Target Protein Sequence
MFKEFKIFIMRGNVVDLAVGIVIGAAFGAIVNSLVKDVLMPPIGLLLGNVDFGNLFIVLK EGAIGGPYESLLVAQTAGAVTINYGVFINALINFLILAMAIFFFVVRPLNQLAARQKSKE AVIPAQTDKKDCPYCATQIPLKASKCPYCTSELM
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane stretch. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Large-conductance mechanosensitive channel (MscL) and what is its basic structure?

MscL is a mechanosensitive channel that opens in response to stretch forces in the lipid bilayer. The channel protein forms a homopentamer with each subunit containing two transmembrane regions. It gates via the bilayer mechanism, which is evoked by hydrophobic mismatch and changes in membrane curvature and/or transbilayer pressure profile. The channel is up-regulated during stationary phase and osmotic shock to prevent cell lysis .

Methodologically, researchers investigating MscL structure should consider:

  • Membrane protein isolation techniques that preserve native oligomeric state

  • Comparative analysis across bacterial species to identify conserved structural elements

  • Consideration of the lipid environment's effects on structural integrity

What makes Dehalococcoides species significant in environmental microbiology research?

Dehalococcoides species are anaerobic bacteria capable of reductive dehalogenation, making them environmentally important for bioremediation. These bacteria contain key enzymes called reductive dehalogenases (RDases) that catalyze the removal of halogen atoms from organohalides. Different strains, such as strain 195 and CBDB1, have distinct dehalogenation capabilities, with strain 195 able to convert PCE to ethene and CBDB1 capable of dehalogenating chlorophenols .

For researchers working with Dehalococcoides:

  • Maintain strictly anaerobic conditions during cultivation and protein extraction

  • Consider strain-specific dehalogenation capabilities when designing experiments

  • Use mixed cultures for initial studies, as pure cultures can be challenging to maintain

What oligomeric states have been proposed for MscL and how do they affect channel function?

Multiple oligomeric states of MscL have been proposed, including tetrameric, pentameric, and hexameric forms. Research indicates that the oligomeric state significantly affects the energetic cost of lipid bilayer deformations during channel gating. Different oligomeric states yield distinct membrane contributions to gating energy and gating tension, effectively creating a functional signature of the channel's structure .

For experimental design:

  • Validate oligomeric state through multiple complementary techniques (e.g., cross-linking, native PAGE, mass spectrometry)

  • Consider how expression systems might affect oligomerization

  • Incorporate oligomeric state predictions into gating models

How does hydrophobic mismatch impact MscL gating characteristics?

The hydrophobic mismatch between MscL and the surrounding lipid bilayer significantly impacts channel gating. Research has shown that:

  • The symmetry and shape of the hydrophobic surfaces of MscL play an important role in regulation of protein function

  • The energetic cost of thickness deformations induced by MscL in the surrounding lipid bilayer is influenced by the channel's hydrophobic profile

  • Different hydrophobic shapes yield distinct membrane contributions to gating energy and tension

Methodologically, researchers should:

  • Carefully select lipid compositions that match or intentionally mismatch the hydrophobic thickness of the protein

  • Consider using lipid bilayers of varying thicknesses to characterize gating properties

  • Employ elastic models to predict how hydrophobic mismatch affects gating energetics

What proteomics approaches have proven effective for studying membrane proteins in Dehalococcoides?

Successful proteomics approaches for Dehalococcoides membrane proteins include:

  • Physical separation of Dehalococcoides cells from mixed cultures followed by membrane protein fractionation

  • Liquid chromatography-tandem mass spectrometry (LC-MS-MS) for peptide detection

  • Comparative analysis using percent protein coverage and exponentially modified protein abundance index (emPAI) values

The table below illustrates protein coverage percentages achieved for various proteins across different Dehalococcoides strains and cultures:

Protein Type (locus tag[s])Strain 195 (Pure)Strain 195 (Mixed)CBDB1KB1SRNL
Cochaperonin GroEL73%66%44%35-58%25-28%
Formate dehydrogenase40%48%11%19-47%2-23%
Putative S-layer protein37%31%17%4-37%4-19%
[Ni/Fe]-hydrogenase45%30%6%3-11%--

Methodological recommendations:

  • Enrich membrane proteins using differential centrifugation and detergent solubilization

  • Use strict identification criteria to avoid false positives

  • Compare results across multiple strains to identify conserved membrane proteins

How can researchers rapidly enrich Dehalococcoides for membrane protein studies?

A novel method for rapid enrichment of Dehalococcoides-like bacteria involves leveraging their hydrophobicity. This approach is based on the hypothesis that organohalide-respiring bacteria are more hydrophobic than other bacteria due to their interaction with hydrophobic compounds. The method separates Dehalococcoides at the interface between aqueous and non-aqueous phases, significantly reducing enrichment times from weeks to minutes or days .

For optimal enrichment:

  • Consider the hydrophobic properties of Dehalococcoides when designing separation protocols

  • Validate enrichment by screening for specific marker genes (e.g., 16S rRNA, RDase genes)

  • Assess membrane protein integrity after separation to ensure channels remain functional

What computational approaches can predict MscL gating characteristics?

Elastic models have proven effective for predicting MscL gating characteristics. These models:

  • Account for the energetic cost of thickness deformations induced by MscL in the surrounding lipid bilayer

  • Can be generalized to incorporate different oligomeric states and hydrophobic shapes

  • Allow quantitative predictions of gating energies and tensions for various structural models

Methodologically, researchers should:

  • Incorporate both protein symmetry and hydrophobic profile into computational models

  • Validate predictions with experimental measurements of gating tension

  • Consider how lipid composition affects model parameters and predictions

How might differential expression of respiratory oxidoreductases in Dehalococcoides inform membrane protein studies?

Proteomic analyses of Dehalococcoides have revealed differential expression of respiratory oxidoreductases, including hydrogenases and reductive dehalogenases. Studies show that:

  • Different RDases are expressed under specific growth conditions (e.g., PceA during PCE reduction, TceA during TCE reduction)

  • Respiratory protein expression varies between pure and mixed cultures

  • Strain-specific differences exist in oxidoreductase expression profiles

For researchers studying membrane proteins:

  • Consider co-expression of relevant respiratory oxidoreductases when designing recombinant systems

  • Monitor expression of key membrane proteins under varying growth conditions

  • Utilize comparative proteomics to identify strain-specific membrane protein characteristics

What methods can address the challenges of expressing anaerobic bacterial membrane proteins?

Expression of membrane proteins from strictly anaerobic bacteria like Dehalococcoides presents unique challenges. Recommended methodological approaches include:

  • Developing oxygen-tolerant expression systems with appropriate chaperones

  • Using heterologous expression in anaerobic hosts that can maintain proper folding

  • Implementing membrane mimetics (nanodiscs, liposomes) that stabilize proteins after purification

A systematic approach should:

  • Screen multiple expression systems (bacterial, yeast, cell-free) under anaerobic conditions

  • Optimize codon usage for the target expression system

  • Incorporate fusion tags that enhance stability without compromising function

  • Validate protein function through electrophysiological or fluorescence-based assays

What pharmacological applications might emerge from MscL studies?

MscL presents promising pharmacological potential, particularly for developing new antibiotics to combat multiple drug-resistant bacterial strains. The channel's conserved structure and essential role in osmoregulation make it an attractive target .

For translational research:

  • Develop high-throughput screening methods for compounds that modulate MscL gating

  • Investigate species-specific differences in MscL structure that could be exploited for selectivity

  • Explore how recombinant expression systems can facilitate drug discovery efforts

How might comparative studies of MscL across different bacterial species advance mechanosensitive channel research?

Comparative studies of MscL across species, including potential channels in Dehalococcoides, could reveal:

  • Evolutionary adaptations of mechanosensitive channels to different membrane environments

  • Conserved gating mechanisms despite structural variations

  • Species-specific regulatory mechanisms that could inform synthetic biology applications

Methodological considerations:

  • Implement phylogenetic analyses to identify conserved functional domains

  • Conduct systematic mutagenesis to test functional conservation

  • Develop chimeric channels to isolate region-specific functional characteristics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.