Recombinant Dehalococcoides sp. Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Description

Introduction to RNase Y

Ribonuclease Y (RNase Y) is a critical endoribonuclease primarily studied in Gram-positive bacteria like Bacillus subtilis, Streptococcus pyogenes, and Streptococcus pneumoniae. It initiates mRNA degradation by cleaving 5′-monophosphorylated RNA ends, particularly in structured regions such as riboswitches or 5′ untranslated regions (UTRs) . While extensively characterized in these organisms, no peer-reviewed studies explicitly mention a recombinant version of RNase Y from Dehalococcoides species.

Functions and Mechanisms of RNase Y

RNase Y serves as a central player in RNA degradation, acting as a functional analog to RNase E in Escherichia coli despite lacking sequence similarity . Key roles include:

FunctionMechanismOrganism
mRNA Decay InitiationCleaves 5′-monophosphorylated RNA ends, targeting AU-rich regions upstream of secondary structures .B. subtilis, S. pyogenes
Riboswitch TurnoverDegrades SAM-dependent riboswitches (e.g., yitJ) by cleaving in the terminator conformation .B. subtilis
AutoregulationRegulates its own mRNA stability via cleavage in the 5′ UTR, modulating protein levels .B. subtilis
Virulence RegulationProcesses 5′ UTRs of virulence genes (e.g., speB in S. pyogenes), requiring conserved G residues for cleavage .S. pyogenes

Potential Research Directions

  1. Homology-Based Cloning:

    • Dehalococcoides RNase Y could be inferred from conserved domains (e.g., catalytic motifs) shared with B. subtilis RNase Y.

    • Example: BLAST analysis of Dehalococcoides genomes for orthologs of rny (e.g., B. subtilis YmdA).

  2. Functional Characterization:

    • Cleavage Specificity: Test substrate preferences (e.g., 5′ monophosphorylated RNAs, riboswitches).

    • Membrane Association: Assess localization via subcellular fractionation.

  3. Ecological Relevance:

    • Investigate RNase Y’s role in regulating Dehalococcoides stress-response or dehalogenase-encoding mRNAs.

Challenges and Knowledge Gaps

ChallengeImplications
Lack of Genomic DataNo annotated rny homologs in Dehalococcoides genomes (e.g., D. mccartyi).
Recombinant ExpressionPotential difficulties in heterologous expression due to membrane-anchoring domains .
Functional RedundancyOverlap with other RNases (e.g., RNase J1/J2) may obscure RNase Y-specific roles .

Comparative Analysis of RNase Y Across Species

OrganismKey FindingsReferences
B. subtilisRNase Y is essential; initiates decay of SAM riboswitches .
S. pyogenesRequired for speB 5′ UTR processing; G residue critical for cleavage .
S. pneumoniaeΔrny mutants show chaining morphology; impacts stress-response genes .
DehalococcoidesNo studies reported; potential for novel regulatory roles.N/A

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rny; DehaBAV1_1354; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-527
Protein Length
full length protein
Species
Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Target Names
rny
Target Protein Sequence
MFEFFMETAPATTTGLPLSAILAIFFSFIIGIVFGGMALFVFRGFIMNRQLRIAQRKATK MLADSKLEAKDVLVEAKREADKTRNSAETELKERRSELAKQENRVIQKTEALDRKLENLE QREQSLTNREKSIDETQSQIEEIRENELKRLEEVANMTTEQAKTSLLEMLEGEMQQETSR RLREWEIKIKAEADEKAREVVSQAIQRCASDVVTETTTNVVPLPSDEMKGRLIGREGRNI RALEQATGVDLIIDDTPEAVTISSFDPVRREVARQALSKLIIDGRIHPARIEEVVTKAKE EVEAAMIASGEQAAYQAGVHGLRPEIIKVMGRLKYRTSYGQNVLQHSIEVAQMSGMIGSE LGVNVTLARRAGFLHDIGKAVDRDVEGTHTQIGADMVKQWEKSPEVIKGVAEHHFDTPTV SIWGFIVSAADAISSARPGARRESLENYIKRLKALEEIADSFKGVEKSFAIQAGREVRIM VKPDEIDDLGAMRLARDIVKRIEDGLEYPGQIKVTVIRETRSVDFAK
Uniprot No.

Target Background

Function
Endoribonuclease initiating mRNA decay.
Database Links
Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Ribonuclease Y and what is its significance in Dehalococcoides sp.?

Ribonuclease Y (RNase Y) is an essential endoribonuclease involved in the initiation of RNA degradation. While extensively characterized in Bacillus subtilis, its role in Dehalococcoides species remains an area of active investigation. In B. subtilis, RNase Y interacts with other RNases, RNA helicase CshA, and glycolytic enzymes in a degradosome-like complex . RNase Y appears to be the functional counterpart of RNase E in Escherichia coli, despite sharing no sequence similarity .

For Dehalococcoides researchers, RNase Y potentially represents a critical component in RNA metabolism and gene regulation. Dehalococcoides species contain multiple reductive dehalogenase genes (rdhA), whose expression patterns are tightly regulated . The RNA processing machinery, including potential RNase Y activity, would play an important role in controlling the stability and abundance of these transcripts.

How does the domain organization of RNase Y relate to its function?

RNase Y contains significant regions of intrinsic disorder, as demonstrated by both experimental and bioinformatic analyses . Its domain organization typically includes:

  • A transmembrane domain at the N-terminus

  • An intrinsically disordered region

  • A KH (K homology) RNA-binding domain

  • A catalytic HD (histidine-aspartate) domain

The membrane localization of RNase Y is essential for both cell viability and protein-protein interactions in B. subtilis . The intrinsically disordered regions likely facilitate multiple protein-protein interactions within the degradosome complex, allowing for dynamic assembly and regulatory flexibility.

What are the optimal conditions for expressing recombinant Dehalococcoides sp. RNase Y?

When designing expression systems for recombinant Dehalococcoides sp. RNase Y, researchers should consider:

  • Host selection: E. coli expression systems may require optimization due to the membrane-associated nature of RNase Y

  • Codon optimization: Dehalococcoides species have unique codon usage patterns

  • Expression temperature: Lower temperatures (16-20°C) may enhance proper folding of the catalytic domain

  • Induction parameters: Careful titration of inducer concentration is necessary to prevent toxicity

  • Inclusion of protease inhibitors: Essential during purification to maintain enzyme integrity

It's important to note that culturing Dehalococcoides sp. requires specialized anaerobic techniques. Dehalococcoides sp. strain MB, for example, requires H₂ as the sole electron donor and specialized culturing conditions .

What techniques are most effective for monitoring RNase Y activity in Dehalococcoides sp.?

Based on methodologies used for studying gene expression in Dehalococcoides:

  • Reverse transcription-PCR (RT-PCR) with gene-specific primers can detect RNase Y transcripts

  • Quantitative PCR (qPCR) can be used to monitor transcript levels, normalizing against housekeeping genes like rpoB, rpoA, or tuf

  • RNA degradation assays using synthetic RNA substrates can assess enzymatic activity

  • Fluorescently labeled RNA substrates can be used to visualize cleavage patterns in gel-based assays

  • For in vivo studies, terminal restriction fragment length polymorphism (t-RFLP) analysis has been successful in studying gene expression in Dehalococcoides

For quantification purposes, it's recommended to relate RNase Y transcript levels to housekeeping genes or to genomic copy numbers, as has been done for other genes in Dehalococcoides species .

How does RNase Y potentially regulate reductive dehalogenase (rdh) gene expression in Dehalococcoides sp.?

This represents a sophisticated research question at the intersection of RNA metabolism and Dehalococcoides sp. biochemistry. Based on known patterns of rdh gene expression:

Dehalococcoides sp. strain CBDB1 contains 32 rdhA genes, whose transcription is differentially regulated in response to chlorinated substrates . The transcription of these genes shows complex patterns with rapid upregulation upon substrate addition, followed by a decrease after dechlorination is complete .

RNase Y potentially influences this regulation through:

  • Differential processing of polycistronic rdhA transcripts

  • Controlling mRNA half-life through specific endonucleolytic cleavage

  • Coordinating with other components of the RNA degradation machinery

  • Responding to environmental cues through protein-protein interactions

The transcript levels of different rdhA genes in Dehalococcoides sp. strain CBDB1 vary by several orders of magnitude, from approximately one transcript per 10,000 cells to one transcript per cell . This variation suggests sophisticated post-transcriptional regulation, potentially involving RNase Y.

What protein-protein interactions might Dehalococcoides sp. RNase Y participate in?

By extrapolating from the B. subtilis model, potential interacting partners of Dehalococcoides sp. RNase Y might include:

  • Other RNases in the Dehalococcoides genome

  • RNA helicases that unwind structured RNA

  • Glycolytic enzymes (potentially enolase and phosphofructokinase)

  • Membrane proteins that anchor the degradosome complex

  • Regulatory proteins that respond to environmental cues

In B. subtilis, RNase Y physically interacts with degradosome partners in vivo, and its membrane localization is essential for these interactions . Similar investigations in Dehalococcoides would likely use bacterial two-hybrid assays and affinity co-purification experiments to identify interacting proteins.

What genomic approaches can be used to study RNase Y function in Dehalococcoides sp.?

Several genomic techniques have been applied to study gene function in Dehalococcoides:

  • Microarray analysis: This has been used to analyze genomic DNA of Dehalococcoides strains . For RNase Y research, microarrays could identify genome-wide changes in transcript abundance following manipulation of RNase Y levels.

  • Comparative genomics: Analysis comparing multiple Dehalococcoides strains can identify conserved features of RNA processing machinery .

  • RNA-Seq: While not explicitly mentioned in the search results, next-generation sequencing would provide high-resolution data on transcriptome changes related to RNase Y activity.

  • Gene-specific primers for PCR: Designed to target specific regions for confirmation of microarray results .

How can researchers differentiate between direct and indirect effects of RNase Y on gene expression in Dehalococcoides sp.?

This challenging question requires sophisticated experimental design:

  • RNA immunoprecipitation (RIP) assays could identify direct RNA targets of RNase Y

  • In vitro cleavage assays with purified recombinant RNase Y and potential target RNAs

  • Pulse-chase experiments to measure RNA half-lives in cells with normal versus depleted RNase Y levels

  • Complementation studies with wild-type versus catalytically inactive RNase Y variants

  • Site-directed mutagenesis of suspected RNase Y cleavage sites in target RNAs

When interpreting results, researchers should consider that Dehalococcoides sp. strain CBDB1 shows complex regulation of its 32 rdhA genes, with most being upregulated similarly after induction with chlorinated compounds, while three rdhA genes (cbdbA1453, cbdbA187, and cbdbA1624) showed differential responses to different trichlorobenzene isomers .

What strategies can resolve issues with recombinant Dehalococcoides sp. RNase Y solubility and activity?

Based on the characteristics of RNase Y and Dehalococcoides research:

  • Solubility challenges:

    • Truncation of the N-terminal transmembrane domain may improve solubility

    • Fusion tags (MBP, SUMO) can enhance solubility while maintaining activity

    • Detergent screening (mild non-ionic detergents) may solubilize the full-length protein

    • Expression at lower temperatures (16-20°C) often improves folding

  • Activity issues:

    • Verify proper metal ion cofactors (particularly divalent cations)

    • Test multiple buffer conditions (pH range 6.5-8.0)

    • Ensure reducing conditions to maintain cysteine residues

    • Consider protein partners that might be necessary for full activity

  • Storage recommendations:

    • Store at -80°C in small aliquots with glycerol (15-20%)

    • Avoid repeated freeze-thaw cycles

    • Include reducing agents in storage buffers

How can researchers address the challenges of RNA stability and degradation in experiments with Dehalococcoides sp.?

RNA work with Dehalococcoides presents unique challenges:

  • Extraction protocols:

    • Use RNase-free reagents and equipment

    • Extract RNA during exponential growth phase for most consistent results

    • Consider fast sample collection methods to capture transient transcripts

  • Normalization strategies:

    • 16S rRNA shows relatively stable copy numbers in Dehalococcoides sp. and can serve as a normalization standard

    • Housekeeping genes like rpoB, rpoA, and tuf have been used successfully

    • Include no-RT controls to verify absence of DNA contamination

  • Sample handling:

    • Treat with RNase inhibitors immediately after cell lysis

    • Use DNase treatment to eliminate genomic DNA contamination

    • For microarray analyses, run in triplicate with appropriate controls

What emerging technologies might advance our understanding of RNase Y in Dehalococcoides sp.?

Several cutting-edge approaches hold promise:

  • CRISPR interference (CRISPRi) systems adapted for Dehalococcoides could allow titrated repression of RNase Y to study partial loss-of-function

  • Single-molecule RNA sequencing could provide detailed insights into RNA processing events

  • Cryo-electron microscopy might reveal structural details of the Dehalococcoides degradosome complex

  • RNA structurome analysis could identify structural features recognized by RNase Y

  • Biosensors that report on RNase Y activity in vivo could allow real-time monitoring

How might recombinant Dehalococcoides sp. RNase Y be engineered for enhanced research applications?

Strategic engineering approaches include:

  • Domain swapping with well-characterized RNases to create chimeric proteins with novel specificities

  • Introduction of affinity tags that permit one-step purification without compromising activity

  • Creation of substrate-specific variants through directed evolution

  • Engineering temperature or pH optima to suit specific experimental conditions

  • Development of conditionally active variants for temporal control of RNA processing

The intrinsically disordered regions present in RNase Y may be particularly amenable to engineering approaches, as these regions often accommodate sequence variations while maintaining functional interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.