Recombinant Deinococcus deserti NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant nuoK is expressed in Escherichia coli using in vitro systems, with an N-terminal His-tag for purification . The full-length protein (1–100 amino acids) is purified to >90% homogeneity via SDS-PAGE . Key production parameters include:

ParameterDetails
Host OrganismE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C (lyophilized) with 50% glycerol
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)

Functional Role in NDH-1

As part of NDH-1, nuoK participates in:

  1. Electron Transfer: Coupling NADH oxidation to quinone reduction via FMN and iron-sulfur centers .

  2. Proton Pumping: Generating a proton gradient critical for ATP synthesis .

Comparison with Deinococcus radiodurans nuoK:

FeatureD. deserti nuoK (1–100 aa) D. radiodurans nuoK (1–103 aa)
Sequence Identity~85% with D. radiodurans
Proton Motive Force (PMF)Confirmed Confirmed
Substrate SpecificityNADH-dependent NADH-dependent

Research Applications

This recombinant protein is utilized in:

  • Electron Transport Studies: Investigating NDH-1’s proton-pumping mechanism .

  • Structural Analysis: Crystallization and cryo-EM studies to resolve membrane topology .

  • ELISA Development: As an antigen in immunoassays for detecting NDH-1 activity .

Challenges and Considerations

  • Solubility: Requires glycerol (5–50%) to maintain stability during storage .

  • Freeze-Thaw Sensitivity: Repeated cycles degrade activity; aliquoting recommended .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
nuoK; Deide_05190; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923)
Target Names
nuoK
Target Protein Sequence
MVPTTYYLALSGLLFALGMIGVLTRRTAIMVFLSVELMLNAANLSLVAFARAWGDLTGQT AVFIVMTLAAAEVAIGLAIIVAIFRKRETTNVDDLAGLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the primary electron acceptor for the enzyme is believed to be menaquinone. This process couples the redox reaction to proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane, thereby conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the nuoK subunit structure in D. deserti compare to that in other bacterial species?

The nuoK subunit in D. deserti likely shares structural similarities with homologs in related species. Based on information from D. geothermalis, nuoK typically contains transmembrane helices with conserved amino acid residues critical for function . The protein sequence suggests a hydrophobic protein embedded in the membrane. Like the E. coli homolog, D. deserti nuoK likely contains conserved acidic residues (glutamic acids) located within transmembrane regions that are critical for ion translocation . The protein also likely contains conserved arginine residues on the cytosolic side that contribute to function. While D. deserti shares many radiation resistance characteristics with other Deinococci, its membrane proteins may have unique adaptations related to its desert habitat, potentially affecting nuoK structure and function .

What expression systems are most suitable for producing recombinant D. deserti nuoK?

For recombinant expression of D. deserti nuoK, researchers should consider the following systems:

  • Homologous expression in Deinococcus species: Similar to the approach used for V. cholerae Na+-NQR, cloning the nuoK gene under the regulation of an inducible promoter (like P(BAD)) in a Deinococcus host may yield functional protein with native post-translational modifications .

  • Heterologous expression in E. coli: Given that E. coli expression systems are well-established for membrane proteins, they can be adapted for D. deserti nuoK using vectors containing affinity tags (like six-histidine tags) to facilitate purification .

  • Cell-free expression systems: For difficult-to-express membrane proteins, cell-free systems may be advantageous, allowing direct incorporation into liposomes or nanodiscs.

The choice depends on research goals - functional studies may benefit from homologous expression, while structural studies might require higher yields from optimized heterologous systems. In all cases, fusion tags should be considered for detection and purification, similar to the approach used for recombinant D. geothermalis nuoK .

How do the conserved amino acid residues in D. deserti nuoK contribute to the ion-translocation mechanism?

The ion-translocation mechanism in D. deserti nuoK likely depends on key conserved residues similar to those identified in homologous proteins. In E. coli NuoK, two highly conserved glutamic acid residues (Glu-36 and Glu-72) located in transmembrane regions are critical for coupled electron transfer and generation of electrochemical gradients . Mutations of these residues in E. coli led to almost complete loss of coupled electron transfer activity while maintaining assembled complex structure.

The mechanism likely involves:

  • Conformational changes in the nuoK subunit triggered by electron transfer through the complex

  • Proton/sodium ion capture by conserved acidic residues

  • Release of ions into the periplasmic space via a channel formed by the membrane domain subunits

Additionally, conserved arginine residues on the cytosolic loops of nuoK appear to be important for coupling activity. In E. coli, simultaneous mutation of two vicinal arginine residues severely impaired coupled activities . These positively charged residues may form part of a charge network essential for ion translocation or interact with other subunits to maintain proper conformational changes during the catalytic cycle.

For D. deserti specifically, site-directed mutagenesis studies targeting these predicted conserved residues would be valuable to determine if the extremophilic nature of this organism has led to adaptations in the ion-translocation mechanism compared to mesophilic bacteria.

What role might the nuoK subunit play in the extreme radiation and desiccation resistance of D. deserti?

The nuoK subunit may contribute indirectly to D. deserti's remarkable radiation and desiccation resistance through several potential mechanisms:

  • Energy conservation during stress: As part of the respiratory chain, nuoK helps maintain energy production under stressful conditions. Efficient energy metabolism is crucial for powering DNA repair mechanisms following radiation damage or rehydration after desiccation .

  • Membrane integrity maintenance: Proper functioning of membrane proteins like nuoK may help preserve membrane integrity during desiccation, which is critical for cell survival.

  • Redox balance: The NADH:quinone oxidoreductase complex helps maintain cellular redox balance, potentially contributing to the management of reactive oxygen species generated during radiation exposure.

Unlike D. radiodurans, which has a condensed ring-like nucleoid structure, D. deserti's nucleoid does not adopt a fixed shape, suggesting that strong nucleoid condensation, rather than shape, may be the common trait conferring radioresistance . This nucleoid organization likely works in concert with membrane functions, including those involving nuoK, to protect cellular components from damage.

Additionally, D. deserti has a high cellular Mn/Fe ratio, similar to other Deinococci, which contributes to oxidative stress resistance . The respiratory chain components, including nuoK, may have evolved specific features to function optimally in this unique metal homeostasis environment.

How does the genomic context of the nuoK gene in D. deserti compare with other Deinococcus species, and what insights does this provide about its evolution?

The genomic context analysis of nuoK in D. deserti compared to other Deinococcus species reveals important evolutionary insights:

D. deserti possesses supplementary DNA repair genes and two functionally different RecA proteins, suggesting unique evolutionary adaptations to its desert habitat . While specific information about nuoK genomic context isn't directly provided in the search results, we can infer that:

  • Like other respiratory complex genes, nuoK is likely part of the nuo operon encoding the NADH:quinone oxidoreductase complex.

  • The gene arrangement may differ from that in D. radiodurans and D. geothermalis, reflecting the specific evolutionary path of D. deserti.

  • D. deserti shows interesting transcriptomic features, with 60% of mRNAs being leaderless (transcription start site at or very close to the translation initiation codon) . This transcriptional organization may affect nuoK expression and regulation.

The genomic comparison between Deinococcus species has already revealed differences in radiation-induced genes - D. deserti lacks homologs of several radiation-induced genes present in D. radiodurans, including ddrP encoding a putative DNA ligase . This suggests divergent evolution of stress response systems among Deinococcus species, which may extend to energy metabolism genes including nuoK.

Comparative analysis would be valuable to determine if nuoK has undergone selective pressure related to the extreme desiccation conditions of desert environments compared to other habitats of Deinococcus species.

What are the optimal purification strategies for recombinant D. deserti nuoK while maintaining its native conformation?

Purifying membrane proteins like D. deserti nuoK while preserving native conformation requires careful consideration of detergents and buffers. Based on successful approaches with similar proteins, the following purification strategy is recommended:

  • Membrane solubilization: Use mild detergents such as dodecyl maltoside (DM) rather than harsher detergents like LDAO. Research with V. cholerae Na+-NQR demonstrated that DM preserved bound ubiquinone and resulted in lower rates of reaction with O₂, better maintaining native properties .

  • Affinity chromatography: Employ a six-histidine tag on the C-terminus of nuoK for efficient purification by metal affinity chromatography, as demonstrated successfully with Na+-NQR .

  • Buffer composition: Include sodium ions in buffers throughout purification, as these ions often stabilize respiratory complex proteins and maintain their activity .

  • Lipid supplementation: Consider adding phospholipids during purification to stabilize the protein structure.

The purification protocol should be optimized as follows:

Purification StepRecommended ConditionsRationale
Cell lysisGentle physical disruption (e.g., French press)Minimizes protein denaturation
Membrane isolationDifferential centrifugationSeparates membrane fraction
Solubilization1% dodecyl maltoside, 4°C, 1 hourPreserves native lipid interactions and cofactors
Affinity purificationNi-NTA, low imidazole washes, elution gradientReduces non-specific binding
Size exclusionSuperdex 200 in buffer with 0.05% DMRemoves aggregates and ensures homogeneity
Storage50% glycerol, -20°C or -80°CPrevents freeze-thaw damage

This approach should yield highly active enzyme suitable for both functional and structural studies while maintaining the integrity of the protein's native conformation.

What spectroscopic techniques are most informative for characterizing the redox centers in recombinant D. deserti nuoK-containing complexes?

For characterizing redox centers in D. deserti nuoK-containing complexes, multiple complementary spectroscopic techniques are recommended:

  • UV-visible spectroscopy: Redox titrations monitored by UV-visible spectroscopy can reveal the number and type of redox centers, as demonstrated with V. cholerae Na+-NQR where three n=2 redox centers and one n=1 redox center were identified . This approach can determine midpoint potentials of the redox active components.

  • EPR (Electron Paramagnetic Resonance) spectroscopy: Essential for characterizing iron-sulfur clusters and semiquinone radicals that may form during catalytic cycles. Different EPR techniques (continuous wave, pulse, high-field) provide detailed information about the electronic structure of paramagnetic centers.

  • Resonance Raman spectroscopy: Particularly useful for characterizing flavin cofactors and their interactions with the protein environment. Can provide information about the protonation state and environment of flavin cofactors.

  • FTIR (Fourier-Transform Infrared) difference spectroscopy: Enables monitoring of conformational changes associated with redox transitions in the protein.

  • MCD (Magnetic Circular Dichroism): Provides information about the electronic structure of metal centers, particularly iron-sulfur clusters.

The data analysis should integrate results from multiple techniques for a comprehensive understanding of the redox centers. For example, midpoint potentials determined by UV-visible spectroscopy should be correlated with EPR signal intensities to assign specific redox transitions to structural components of the complex. This multi-technique approach will provide insights into how electron transfer through these redox centers couples to ion translocation in the membrane domain where nuoK resides.

How can site-directed mutagenesis be optimized to investigate key functional residues in D. deserti nuoK?

Optimizing site-directed mutagenesis for investigating D. deserti nuoK functional residues requires a systematic approach:

  • Target residue selection:

    • Focus on conserved acidic residues (glutamates) in transmembrane regions, which are likely crucial for ion translocation based on studies in E. coli homologs

    • Investigate conserved arginine residues on cytosolic loops that may be involved in coupling mechanisms

    • Consider residues unique to extremophilic Deinococcus species that may contribute to protein stability

  • Mutation design strategy:

    • Conservative substitutions: Replace glutamate with aspartate or glutamine to distinguish between charge and hydrogen bonding requirements

    • Charge reversals: Substitute acidic residues with basic ones (Glu→Arg) to test electrostatic interactions

    • Hydrophobicity changes: Replace charged residues with neutral ones of similar size (Glu→Leu) to assess charge necessity

  • Expression system selection:

    • For functional studies, use homologous expression in a D. deserti host strain with the genomic copy of nuoK deleted, similar to the approach used for V. cholerae Na+-NQR

    • For high-throughput screening, consider E. coli expression if the protein folds correctly

  • Functional assessment protocol:

    • Assay assembly of the complete complex using blue-native gel electrophoresis and immunostaining

    • Measure coupled electron transfer activities (NADH:quinone oxidoreductase activity)

    • Assess ion translocation using reconstituted proteoliposomes with fluorescent probes for membrane potential and ion gradients

    • Perform thermal stability assays to determine if mutations affect protein stability

  • Validation approach:

    • Perform complementary mutations at interacting positions to restore function

    • Use computational modeling to predict and validate structural changes

    • Compare results with homologous mutations in related species to identify conserved mechanisms

This systematic approach should elucidate the key functional residues in D. deserti nuoK and their specific roles in the coupling mechanism, potentially revealing adaptations unique to this extremophilic bacterium.

How should researchers interpret differences in electron transfer and ion translocation activities between wild-type and recombinant D. deserti nuoK?

When interpreting differences in electron transfer and ion translocation activities between wild-type and recombinant D. deserti nuoK, researchers should consider multiple factors:

  • Expression system effects:

    • Recombinant expression may result in improper folding or missing post-translational modifications

    • The lipid environment in expression hosts differs from native D. deserti membranes, potentially affecting activity

    • Expression levels may differ from native conditions, altering stoichiometry with other complex subunits

  • Purification artifacts:

    • Detergent choice significantly impacts cofactor retention and activity, as seen with V. cholerae Na+-NQR where dodecyl maltoside preserved ubiquinone content while LDAO resulted in negligible quinone content

    • Loss of loosely bound cofactors during purification may reduce activity

    • Protein stability may decrease over time during purification steps

  • Assay conditions:

    • Reconstitution efficiency into liposomes affects measured ion translocation

    • Buffer conditions (pH, salt concentration) must be optimized for D. deserti's native environment

    • Temperature and substrate concentration must be carefully controlled

  • Statistical analysis approach:

    • Calculate turnover numbers (e.g., electrons per second) to normalize for protein concentration differences

    • Use multiple technical and biological replicates to ensure reproducibility

    • Apply appropriate statistical tests (ANOVA, t-tests) to determine significance of differences

  • Validation strategy:

    • Compare recombinant protein from different expression systems

    • Test complementation of nuoK deletion mutants with recombinant protein

    • Perform side-by-side analysis of membrane preparations and purified protein

Differences should be interpreted in the context of D. deserti's extremophilic nature, as adaptations to desert environments may result in unique properties compared to mesophilic homologs. Researchers should also consider the broader respiratory chain context, as nuoK functions as part of a multisubunit complex where activity depends on proper assembly and interactions with partner subunits.

What approaches should be used to correlate structural features of D. deserti nuoK with its functional role in ion translocation?

Correlating structural features of D. deserti nuoK with its functional role in ion translocation requires an integrated multi-disciplinary approach:

  • Structural prediction and analysis:

    • Generate computational models based on homologous proteins like the E. coli NuoK (ND4L) subunit

    • Identify conserved residues in transmembrane regions that may form ion channels

    • Predict conformational changes during the catalytic cycle using molecular dynamics simulations

    • Map the conservation pattern of amino acids onto the structural model to identify functionally important regions

  • Structure-guided mutagenesis:

    • Target predicted channel-forming residues, particularly conserved charged amino acids in transmembrane domains

    • Create systematic mutations of conserved glutamate residues that may be involved in ion binding and translocation

    • Design double mutants to test predictions about interacting residues

  • Functional measurements:

    • Develop assays that can distinguish between electron transfer and ion translocation activities

    • Use reconstituted proteoliposomes to directly measure ion movement across membranes

    • Apply electrophysiological techniques to measure ion conductance

  • Correlation analysis:

    • Establish structure-function relationships by mapping activity changes from mutations onto structural models

    • Use statistical approaches to identify patterns between structural features and functional parameters

    • Compare results with homologous proteins from different organisms to identify conserved mechanisms

  • Integration with whole-complex studies:

    • Consider nuoK in the context of the entire NADH:quinone oxidoreductase complex

    • Analyze interactions with adjacent subunits that may influence ion translocation

    • Study how the extremophilic adaptations of D. deserti might influence these interactions

This integrated approach will help establish clear correlations between specific structural elements of D. deserti nuoK and their functional roles in the ion translocation mechanism, potentially revealing unique adaptations that contribute to D. deserti's survival in extreme environments.

What are the most common challenges in expressing and purifying functional recombinant D. deserti nuoK, and how can they be addressed?

Researchers working with recombinant D. deserti nuoK typically encounter several challenges during expression and purification. The following table outlines these challenges and provides evidence-based solutions:

ChallengePotential SolutionsRationale
Low expression levelsUse codon optimization for the host system; Try fusion partners (MBP, SUMO); Test different promoter strengthsCodon optimization improves translation efficiency; Fusion tags can enhance folding; Promoter strength affects expression levels
Protein aggregationExpress at lower temperatures (16-20°C); Add chemical chaperones to growth media; Include glycerol in buffersLower temperatures slow folding; Chaperones assist correct folding; Glycerol stabilizes protein structure
Poor membrane integrationUse specialized E. coli strains (C41/C43); Consider cell-free expression systems; Try homologous expression in Deinococcus speciesC41/C43 strains are designed for membrane proteins; Cell-free systems can directly incorporate into membranes; Homologous expression maintains native machinery
Loss of cofactors during purificationUse milder detergents (DDM, digitonin); Include potential cofactors in buffers; Minimize purification stepsMilder detergents preserve protein-cofactor interactions; Buffer supplementation prevents cofactor dissociation; Fewer steps reduce losses
Instability of purified proteinStore in 50% glycerol at -20°C/-80°C; Avoid repeated freeze-thaw cycles; Consider nanodiscs for maintaining lipid environmentGlycerol prevents ice crystal formation; Freeze-thaw damages structure; Nanodiscs provide native-like environment
Lack of functional activityReconstitute with native lipids; Include all complex subunits; Ensure proper redox environmentLipid composition affects function; nuoK functions within a complex; Redox environment maintains cofactor states

For D. deserti specifically, the extremophilic nature of this organism presents additional challenges. The protein may require specific conditions reflecting its desert habitat adaptation. Researchers might consider adding Mn²⁺ to expression and purification buffers, as Deinococcus species have high Mn/Fe ratios that contribute to their stress resistance . Additionally, testing different detergent-to-protein ratios is crucial, as membrane proteins from extremophiles often have distinct hydrophobic surface properties.

How should researchers address unexpected results in site-directed mutagenesis studies of D. deserti nuoK?

When researchers encounter unexpected results in site-directed mutagenesis studies of D. deserti nuoK, they should employ a systematic troubleshooting and interpretation approach:

  • Verification steps:

    • Confirm mutation by DNA sequencing of the entire gene to ensure no secondary mutations occurred

    • Verify protein expression levels by Western blot to ensure comparable expression between wild-type and mutant

    • Check complex assembly status using blue-native gel electrophoresis, as seen in E. coli NuoK studies

    • Assess protein stability and folding using thermal shift assays or limited proteolysis

  • Comparative analysis strategy:

    • Test equivalent mutations in homologous proteins from related species (D. radiodurans, D. geothermalis)

    • Compare with published data on similar mutations in other bacterial species like E. coli

    • Consider the distinct environmental adaptations of D. deserti that might influence residue functions

  • Extended experimental approaches:

    • Perform suppressor mutation screens to identify compensatory changes

    • Create double or triple mutants to test hypotheses about functional networks

    • Apply molecular dynamics simulations to understand the structural consequences of mutations

    • Use alternative assays to measure different aspects of protein function

  • Interpretation framework:

    • Consider indirect effects on protein dynamics rather than direct catalytic roles

    • Evaluate potential long-range conformational changes affecting distant functional sites

    • Assess the possibility of species-specific functional differences related to D. deserti's extremophilic nature

    • Examine whether mutations affect interactions with other complex subunits

  • Hypothesis refinement:

    • Develop new mechanistic models that accommodate unexpected results

    • Design follow-up experiments specifically to test these refined hypotheses

    • Consider alternate roles for conserved residues (structural versus functional)

For example, if mutations of conserved glutamate residues don't affect activity as expected based on E. coli studies , researchers should consider whether D. deserti uses alternative residues for ion translocation, possibly as an adaptation to its extreme environment. The highly condensed nucleoid and unique cellular characteristics of Deinococcus species might also influence membrane protein function in ways not seen in other bacteria .

What emerging technologies could advance our understanding of D. deserti nuoK and its role in extremophile bioenergetics?

Several cutting-edge technologies show promise for revealing new insights about D. deserti nuoK and extremophile bioenergetics:

  • Cryo-electron microscopy (cryo-EM):

    • High-resolution structural determination of entire respiratory complexes in native-like environments

    • Time-resolved cryo-EM to capture different conformational states during the catalytic cycle

    • In situ structural studies within cellular contexts to understand organization in the extremophile membrane

  • Advanced genetic tools:

    • CRISPR-Cas9 genome editing optimized for Deinococcus species to create precise mutations

    • Inducible gene expression systems specifically designed for extremophiles

    • Single-cell tracking of protein dynamics in live D. deserti cells using fluorescent protein fusions

  • Computational approaches:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations to model electron transfer coupled to ion translocation

    • Machine learning algorithms to identify patterns in sequence-structure-function relationships across species

    • Systems biology modeling of entire respiratory networks under extreme conditions

  • Biophysical techniques:

    • Nanoscale electrochemistry using modified electrodes to probe electron transfer in single complexes

    • High-pressure techniques to study protein function under conditions mimicking D. deserti's natural environment

    • Advanced EPR methods (DEER, ENDOR) to measure distances between cofactors and conformational changes

  • Synthetic biology approaches:

    • Creation of minimal respiratory complexes with defined components to test specific hypotheses

    • Engineering of hybrid complexes combining subunits from different species to identify determinants of extremophile adaptations

    • Directed evolution to enhance specific properties of nuoK and understand adaptation mechanisms

These emerging technologies could specifically address how D. deserti's respiratory complexes maintain function under extreme desiccation and radiation conditions, potentially revealing unique structural features or regulatory mechanisms in nuoK that contribute to the organism's remarkable resilience. The insights gained could have broader implications for understanding bioenergetic adaptations to extreme environments and potentially inform the design of stable bioelectronic devices or biocatalysts for harsh industrial conditions.

How might research on D. deserti nuoK contribute to our understanding of the evolution of respiratory complexes in extremophiles?

Research on D. deserti nuoK offers unique opportunities to understand the evolutionary adaptations of respiratory complexes in extremophiles:

  • Evolutionary pressure analysis:

    • Comparative genomics across Deinococcus species occupying different extreme environments can reveal selection pressures on nuoK

    • Calculation of dN/dS ratios (nonsynonymous to synonymous substitution rates) can identify residues under positive selection

    • Reconstruction of ancestral sequences can highlight the evolutionary trajectory of respiratory complexes in adapting to extreme environments

  • Structure-function relationship across phylogeny:

    • D. deserti's adaptation to desert conditions may have selected for specific nuoK modifications

    • Comparison with D. radiodurans (radiation-resistant) and D. geothermalis (thermophilic) can reveal environment-specific adaptations

    • Analysis of conserved versus variable regions can distinguish core functional elements from adaptable features

  • Horizontal gene transfer assessment:

    • Identification of potential horizontal gene transfer events affecting respiratory chain components

    • Analysis of genomic context of nuoK across species can reveal operon rearrangements or gene acquisitions

    • Comparison with other extremophiles outside the Deinococcus genus may reveal convergent evolution

  • Co-evolution patterns:

    • Examination of coordinated changes between nuoK and other complex I subunits

    • Analysis of co-evolution with other cellular systems (e.g., DNA repair, oxidative stress response)

    • Study of evolutionary linkages between respiratory complexes and the highly condensed nucleoid characteristic of Deinococci

  • Adaptation mechanisms:

    • Identification of specific amino acid changes associated with desiccation resistance

    • Understanding how protein stability mechanisms evolve in response to extreme conditions

    • Correlation between transcriptomic features (such as D. deserti's high proportion of leaderless mRNAs ) and protein evolution

This research could reveal whether extremophilic adaptations in respiratory complexes follow predictable patterns or represent unique solutions to environmental challenges. The findings might challenge our current understanding of structure-function relationships in respiratory complexes and reveal unexplored mechanisms of energy conservation under extreme conditions. Additionally, understanding these evolutionary adaptations could provide insights into the limits of life on Earth and potentially on other planets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.