Recombinant Deinococcus geothermalis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

NADPH vs. NADH Preferential Pathways

Deinococcus species prioritize the pentose phosphate pathway (PPP) over glycolysis to regenerate NADPH, a cofactor critical for oxidative stress repair . This minimizes NADH production, reducing reactive oxygen species (ROS) during electron transport. While nuoK is conserved in D. geothermalis, its activity may be modulated under stress to balance redox states .

Stress Resistance Mechanisms

The organism’s radiation/desiccation resistance correlates with:

  1. Redundant repair systems: Genes for DNA repair and antioxidant enzymes are amplified .

  2. LMW thiols: Mycothiol (MSH) biosynthesis pathways compensate for cysteine-related redox imbalances .

Though nuoK’s direct role in stress resistance remains unclear, its association with NADH-quinone oxidoreductase activity positions it in pathways countering oxidative damage .

Research Applications and Diagnostic Tools

Recombinant nuoK is utilized in:

ELISA-Based Detection

Commercially available ELISA kits (e.g., CSB-CF628258DAAD) enable quantification of nuoK in D. geothermalis or engineered systems. These kits use recombinant protein as a standard .

Mechanistic Studies

  • Electron transport analysis: Structural studies of truncated nuoK may reveal insights into NDH-1 assembly and function.

  • Metabolic engineering: Modulating nuoK expression could optimize NADH/NADPH ratios in biotechnological applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
nuoK; Dgeo_0919; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Deinococcus geothermalis (strain DSM 11300)
Target Names
nuoK
Target Protein Sequence
MAPTAYYVALSGLLFAIGMIGVLTRRTAIMIFLSVELMLNAANLALVAFARAWGDLTAQT AVFIVMTLAAAEVAIGLAIIVAIFRKRETTNVDDLATLKG
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, the primary electron acceptor is believed to be a menaquinone. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic classification of Deinococcus geothermalis and why is it significant for NADH-quinone oxidoreductase studies?

Deinococcus geothermalis belongs to the deeply branched bacterial phylum Deinococcus-Thermus, which is renowned for its extremophilic species. The significance of studying NADH-quinone oxidoreductase from this organism stems from D. geothermalis' extraordinary resistance to radiation (IR and UV) and desiccation, as well as its ability to thrive in both aerobic and anaerobic conditions . This extremophile was initially isolated from geothermal springs and subsequently discovered in deep-ocean subsurfaces, demonstrating its metabolic versatility . The NADH-quinone oxidoreductase complex from D. geothermalis is particularly interesting as it functions in these extreme environments, potentially with unique adaptations that allow electron transport chain functionality under radiation, temperature stress, and varying oxygen conditions.

How does the recombinant expression system affect the properties of nuoK protein?

Expression in E. coli may not perfectly replicate the post-translational modifications or folding environment that would be present in the native D. geothermalis. This is particularly relevant for nuoK, as membrane proteins often require specific lipid environments for proper folding and function. Researchers should account for these potential differences when interpreting functional studies of the recombinant protein compared to its native form .

The addition of the His-tag, while facilitating purification, may also subtly alter protein-protein interactions or the protein's orientation within experimental membrane systems. Control experiments comparing tagged and untagged versions may be necessary for critical functional studies.

What is the optimal protocol for recombinant expression and purification of D. geothermalis nuoK?

The optimal protocol for recombinant expression and purification of D. geothermalis nuoK includes the following methodological steps:

  • Cloning and Vector Selection: Clone the nuoK gene (encoding amino acids 1-100) into an expression vector with an N-terminal His-tag for affinity purification.

  • Expression Host: Transform the vector into an E. coli strain optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3)) .

  • Culture Conditions: Grow cultures at lower temperatures (20-25°C) after induction to promote proper folding of the membrane protein.

  • Induction Parameters: Induce with a lower concentration of IPTG (0.1-0.5 mM) to prevent formation of inclusion bodies.

  • Cell Disruption: Use gentle cell disruption methods to preserve membrane protein integrity.

  • Purification:

    • Solubilize membranes with appropriate detergents (e.g., n-dodecyl β-D-maltoside)

    • Purify using immobilized metal affinity chromatography (IMAC)

    • Include detergent in all purification buffers

    • Consider size exclusion chromatography as a polishing step

  • Quality Control: Verify protein purity by SDS-PAGE (should be >90%) .

  • Storage: Store the purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0, aliquot to avoid repeated freeze-thaw cycles, and maintain at -20°C/-80°C for long-term storage .

When designing experimental protocols, researchers should consider implementing the Solomon 4-Group Design to evaluate whether pre-testing affects the outcomes of functional assays with the purified protein . This experimental design approach allows for robust validation of results by comparing experimental and control groups with and without pre-testing.

What spectroscopic techniques are most effective for analyzing D. geothermalis NADH-quinone oxidoreductase cofactor content?

For analyzing cofactor content in D. geothermalis NADH-quinone oxidoreductase, several spectroscopic techniques can be employed strategically:

  • UV-Visible Spectroscopy (300-800 nm range): This is the primary technique for identifying flavin and iron-sulfur clusters. NADH-quinone oxidoreductases typically show characteristic absorption maxima at approximately 455 nm for flavins (FAD/FMN) and 450 nm for iron-sulfur clusters . The presence of a yellow color in the purified protein solution is often indicative of bound flavin cofactors.

  • Cofactor Release Analysis: To confirm the nature of bound cofactors, perform controlled denaturation using 5% trichloroacetic acid at 100°C for 2 hours, followed by centrifugation and re-measurement of the spectrum. The disappearance of the 455 nm signal would confirm that the cofactor is tightly bound to the protein rather than being a contaminant .

  • EPR Spectroscopy: For detailed characterization of iron-sulfur clusters, electron paramagnetic resonance spectroscopy provides information about the oxidation states and specific type of Fe-S centers.

  • Fluorescence Spectroscopy: Can provide additional confirmation of flavin cofactors through their characteristic fluorescence emission.

  • Circular Dichroism: While primarily used for secondary structure determination, CD can also provide information about cofactor binding through observation of spectral changes upon cofactor addition or removal.

When analyzing cofactor content, comparisons with related NADH-quinone oxidoreductases from other organisms can provide valuable context. For instance, similar cofactor analysis techniques have been successfully applied to NADH:quinone oxidoreductases from Methanothermobacter marburgensis and E. coli, revealing the presence of flavins and iron-sulfur clusters .

How should enzyme kinetic assays be designed for accurate characterization of nuoK activity?

Designing enzyme kinetic assays for accurate characterization of D. geothermalis nuoK activity requires careful consideration of several methodological aspects:

  • Substrate Selection:

    • Primary electron donor: Test both NADH and NADPH, as NADH is typically preferred by bacterial NADH:quinone oxidoreductases

    • Electron acceptors: Evaluate multiple artificial electron acceptors including:

      • 1,4-benzoquinone (1,4-BQ)

      • Coenzyme Q1

      • 2,6-dichlorophenolindophenol (DCPIP)

      • Potassium ferricyanide

      • Ferrocenium hexafluorophosphate

  • Assay Conditions:

    • Buffer selection: Test multiple buffers across pH range (5.5-9.0) including citrate, carbonate, phosphate, Tris, and glycine buffers

    • Temperature optimization: Given D. geothermalis is thermophilic, assay at elevated temperatures (30-65°C)

    • Divalent cation requirements: Include manganese ions given their importance for D. geothermalis oxidative stress management

  • Kinetic Parameters Determination:

    • Measure initial velocities at various substrate concentrations

    • Use both Lineweaver-Burk and non-linear regression analysis to determine:

      • Km values for electron donors (expected range: 17-258 µM based on similar enzymes)

      • kcat values (expected range: 4.95-19.8 min⁻¹)

      • Catalytic efficiency (kcat/Km)

  • Data Analysis:

    • Apply appropriate experimental design notation to clearly document the conditions

    • Generate a table comparing kinetic parameters across different electron donor/acceptor pairs

    • Include statistical analysis to determine significance of differences observed

Based on studies of related NADH:quinone oxidoreductases, expect higher affinity and turnover rates for NADH compared to NADPH, with potential variations in kinetic constants depending on the electron acceptor used . For accurate characterization, include control assays with known NADH:quinone oxidoreductases from E. coli or Thermus thermophilus for direct comparison.

What are the key differences between D. geothermalis NADH-quinone oxidoreductase and homologous proteins from other extremophiles?

D. geothermalis NADH-quinone oxidoreductase exhibits several distinctive characteristics when compared to homologous proteins from other extremophiles:

  • Radiation Resistance Adaptations: Unlike NADH-quinone oxidoreductases from non-radiation resistant organisms, the D. geothermalis enzyme likely possesses structural features that protect against radiation-induced damage. These may include additional stabilizing interactions and specialized arrangements of iron-sulfur clusters that are less susceptible to oxidative damage during radiation exposure .

  • Temperature Adaptations: Compared to mesophilic homologs, the D. geothermalis enzyme contains adaptations for functioning at elevated temperatures, though not as extreme as those found in hyperthermophiles like Thermus thermophilus. The T. thermophilus enzyme shows a Km value of approximately 10 μM for NADH with coenzyme Q1, whereas the D. geothermalis enzyme would likely have an intermediate value between this and the E. coli enzyme (14 μM) .

  • Manganese Dependency: A key distinguishing feature of D. geothermalis metabolism is its strong reliance on manganese for combating oxidative stress. The NADH-quinone oxidoreductase system in D. geothermalis appears to be linked to manganese availability, with manganese addition reinitializing respiration and proliferation . This manganese dependency is less pronounced in other extremophile NADH-quinone oxidoreductases.

  • Metabolic Integration: D. geothermalis uniquely channels central carbon metabolism to pathways that predominantly generate NADPH rather than NADH when under oxidative stress, which influences the role and regulation of its NADH-quinone oxidoreductase compared to homologs from other extremophiles .

  • Structural Differences: The nuoK subunit likely contains specific structural adaptations that facilitate its function within the unique membrane composition of D. geothermalis, which differs from that of other extremophiles due to its specialized lipid content that contributes to radiation and desiccation resistance.

These differences highlight the specialized nature of D. geothermalis NADH-quinone oxidoreductase within the context of extremophile adaptations, making it a valuable model for studying electron transport chains under extreme conditions.

How does the nuoK subunit interact with other components of the NADH-quinone oxidoreductase complex?

The nuoK subunit plays a crucial role in the structural and functional integrity of the NADH-quinone oxidoreductase complex through several key interactions:

When studying these interactions experimentally, researchers should consider using techniques such as cross-linking studies, co-immunoprecipitation, or blue native PAGE to preserve and analyze the native interactions between nuoK and other subunits. Molecular modeling approaches based on homologous complexes (such as those from E. coli or T. thermophilus) can also provide valuable insights into the specific interaction interfaces of the D. geothermalis nuoK subunit.

What mechanisms contribute to the oxidative stress resistance of D. geothermalis NADH-quinone oxidoreductase?

The oxidative stress resistance of D. geothermalis NADH-quinone oxidoreductase involves several sophisticated mechanisms that allow this enzyme to function even under conditions of high reactive oxygen species (ROS):

  • Manganese-Dependent Protection Systems: D. geothermalis preferentially utilizes manganese-dependent enzymes for combating ROS. The NADH-quinone oxidoreductase activity is linked to manganese availability, with experimental evidence showing that addition of soluble Mn reinitiated respiration and proliferation with concomitant acidification . This suggests that the enzyme complex is designed to operate efficiently in manganese-rich environments that support the organism's oxidative stress defense system.

  • Metabolic Adaptations: Under oxidative stress conditions, D. geothermalis channels central carbon metabolism toward pathways that generate NADPH rather than NADH. This metabolic shift is significant because NADPH is the preferred electron donor for many antioxidant systems. The NADH-quinone oxidoreductase complex appears to be integrated with this metabolic adaptation, potentially through regulatory mechanisms that respond to the NADH/NADPH ratio .

  • Succinate Production: A unique feature of D. geothermalis metabolism is the conversion of a major part of carbon substrate into succinate, which serves not as a fermentation product but likely as an ROS-combating metabolite. The NADH-quinone oxidoreductase complex may be involved in electron transfer processes that support this specialized succinate production pathway .

  • Protein Repair Systems Integration: The oxidative stress response in D. geothermalis includes upregulation of various protein repair enzymes, including FeS cluster assembly proteins of the iron-sulfur cluster assembly protein system. These repair systems likely help maintain the integrity of the iron-sulfur clusters within the NADH-quinone oxidoreductase complex when exposed to oxidative damage .

  • Structural Robustness: The NADH-quinone oxidoreductase complex from D. geothermalis likely possesses structural features that provide inherent resistance to oxidative damage, potentially including:

    • Specialized arrangement of iron-sulfur clusters with reduced susceptibility to oxidation

    • Additional stabilizing interactions that maintain structural integrity under stress

    • Modified quinone binding sites that minimize ROS generation during electron transfer

These mechanisms collectively contribute to the remarkable ability of D. geothermalis NADH-quinone oxidoreductase to function under conditions that would inactivate homologous enzymes from non-extremophilic organisms.

How can recombinant D. geothermalis nuoK be applied in bioenergetic studies of extremophile metabolism?

Recombinant D. geothermalis nuoK offers several sophisticated applications for bioenergetic studies of extremophile metabolism:

What are the challenges and solutions for studying the proton-pumping mechanism of recombinant nuoK in membrane systems?

Studying the proton-pumping mechanism of recombinant D. geothermalis nuoK presents several sophisticated challenges with corresponding methodological solutions:

Challenges and Solutions:

  • Reconstitution in Artificial Membrane Systems

    • Challenge: Maintaining the native conformation and orientation of nuoK in artificial membranes.

    • Solution: Employ directed reconstitution techniques using His-tag as an orientation guide, with careful selection of lipid compositions that mimic D. geothermalis membranes. Include cardiolipin and other specialized lipids known to support extremophile membrane proteins.

  • Complex Assembly

    • Challenge: NuoK functions as part of a multi-subunit complex, making isolated studies difficult.

    • Solution: Use two complementary approaches:

      • Co-express multiple subunits with compatible affinity tags for purification of sub-complexes

      • Develop partial reconstruction systems focusing on the membrane domain subunits (including nuoH, nuoJ, nuoK, nuoL, nuoM, and nuoN)

  • Proton Movement Detection

    • Challenge: Quantifying the small proton fluxes associated with nuoK activity.

    • Solution: Implement high-sensitivity approaches including:

      • pH-sensitive fluorescent probes incorporated into proteoliposomes

      • Stopped-flow spectroscopy with rapid kinetic measurements

      • Patch-clamp electrophysiology of reconstituted membranes

  • Distinguishing Passive Leakage from Active Transport

    • Challenge: Differentiating between active proton pumping and passive leakage.

    • Solution: Design control experiments with:

      • Site-directed mutagenesis of key residues in the proposed proton pathway

      • Ionophore controls to establish maximum uncoupled rates

      • Comparison with known proton pump inhibitors

  • Maintaining Activity in Artificial Systems

    • Challenge: Preserving the electron transport activity upon reconstitution.

    • Solution: Optimize reconstitution conditions including:

      • Testing various detergents for solubilization and reconstitution

      • Including stabilizing agents such as glycerol or trehalose

      • Adding cofactors (FAD, FMN, iron-sulfur cluster precursors) during reconstitution

Experimental Design Considerations:

When designing experiments to study proton-pumping mechanisms, implement robust experimental design principles such as those outlined in experimental design notation . A variation of the classic experiment that includes multiple control groups would be particularly valuable for distinguishing true proton-pumping activity from artifacts.

The experimental design should also account for the unique characteristics of D. geothermalis, particularly its manganese dependency for optimal respiratory function . Including manganese in the experimental buffers at physiologically relevant concentrations may be critical for observing native-like proton-pumping activity.

How can molecular dynamics simulations enhance our understanding of nuoK function in extreme environments?

Molecular dynamics (MD) simulations offer powerful approaches to understanding nuoK function in extreme environments, providing atomic-level insights that are difficult to obtain experimentally:

  • Radiation Damage Simulation

    • Implement specialized MD protocols that simulate radiation events and track structural changes in nuoK

    • Model the effects of ionizing radiation on critical residues and cofactors

    • Simulate repair pathways and protein resilience mechanisms post-radiation exposure

    • Compare simulations of D. geothermalis nuoK with non-extremophile homologs to identify structural features conferring radiation resistance

  • Temperature Adaptation Modeling

    • Conduct parallel simulations across temperature ranges (30-65°C) to identify temperature-dependent conformational changes

    • Analyze hydrogen bond networks and salt bridges that contribute to thermostability

    • Model protein flexibility and rigidity at different temperatures to identify regions that maintain functional conformations at elevated temperatures

    • Correlate simulated thermal motion with experimental biochemical data on temperature-dependent activity

  • Proton Translocation Pathway Mapping

    • Apply enhanced sampling techniques (umbrella sampling, metadynamics) to map the energetics of proton movement through nuoK

    • Identify key residues forming the proton channel through water wire simulations

    • Calculate pKa shifts of key residues in different conformational states

    • Model the coupling between electron transfer and proton movement

  • Membrane Integration Simulations

    • Simulate nuoK in native-like membrane environments with appropriate lipid compositions

    • Model protein-lipid interactions that stabilize the complex in extreme conditions

    • Analyze membrane thickness and fluidity effects on protein function

    • Identify potential lipid-binding sites that may regulate activity

  • Subunit Interaction Networks

    • Perform multi-subunit simulations to map the dynamic interactions between nuoK and neighboring subunits

    • Calculate binding energies and identify critical interaction interfaces

    • Model conformational changes propagated from one subunit to another during the catalytic cycle

    • Simulate the effects of mutations at subunit interfaces on complex stability and function

Simulation Parameters and Validation:

For meaningful MD simulations of D. geothermalis nuoK, several specialized parameters should be considered:

  • Membrane Composition: Include higher proportions of saturated lipids and unique lipid species found in D. geothermalis membranes

  • Ion Concentrations: Incorporate physiologically relevant manganese concentrations based on the organism's unique manganese dependency

  • Validation Approach: Implement a Solomon 4-Group Design-inspired validation strategy where multiple simulation conditions are compared against experimental controls to distinguish simulation artifacts from biologically relevant findings

By integrating these molecular dynamics approaches with experimental data, researchers can develop a comprehensive understanding of nuoK function at the atomic level, providing insights that would be impossible to obtain through experimental techniques alone.

What are common challenges in recombinant expression of D. geothermalis nuoK and how can they be addressed?

Recombinant expression of D. geothermalis nuoK presents several technical challenges that require systematic troubleshooting approaches:

  • Low Expression Yield

    • Challenge: Membrane proteins like nuoK often express poorly in heterologous systems.

    • Solutions:

      • Optimize codon usage for the expression host (E. coli)

      • Test specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))

      • Implement auto-induction media to provide gradual protein expression

      • Lower induction temperature to 18-20°C to reduce formation of inclusion bodies

      • Add membrane protein expression enhancers such as 1% glucose or 4% ethanol to growth media

  • Protein Misfolding

    • Challenge: Improper folding in the E. coli membrane environment.

    • Solutions:

      • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

      • Add chemical chaperones such as glycerol (5-10%) to the culture medium

      • Test fusion partners that enhance membrane integration (e.g., MBP, GFP)

      • Implement slow expression strategies with very low IPTG concentrations (0.1 mM)

  • Protein Aggregation During Purification

    • Challenge: Protein aggregation after extraction from membranes.

    • Solutions:

      • Screen multiple detergents (DDM, LMNG, digitonin) for optimal solubilization

      • Include stabilizing agents in all buffers (glycerol, trehalose)

      • Maintain pH 8.0 throughout purification as specified for optimal stability

      • Use rapid purification protocols to minimize time in detergent solution

      • Add lipids during purification to stabilize the native structure

  • Degradation During Storage

    • Challenge: Protein degradation during storage.

    • Solutions:

      • Aliquot immediately after purification to avoid repeated freeze-thaw cycles

      • Store in Tris/PBS-based buffer with 6% trehalose as recommended

      • Consider flash-freezing in liquid nitrogen rather than slow freezing

      • Test lyophilization for long-term storage as suggested in product specifications

  • Loss of Cofactors

    • Challenge: Loss of essential cofactors during purification.

    • Solutions:

      • Supplement purification buffers with potential cofactors (FAD, FMN)

      • Include trace amounts of iron and sulfur sources for Fe-S cluster maintenance

      • Monitor cofactor retention using spectroscopic methods (absorption at 455 nm)

      • Consider reconstitution of cofactors after purification if necessary

These troubleshooting approaches should be implemented within a systematic experimental design framework, potentially using factorial design to identify optimal combinations of conditions . For each optimization experiment, proper controls should be included to ensure that changes in protocol genuinely improve the quantity and quality of the recombinant protein.

How can researchers optimize activity assays for D. geothermalis NADH-quinone oxidoreductase under different experimental conditions?

Optimization of activity assays for D. geothermalis NADH-quinone oxidoreductase requires careful consideration of multiple parameters to ensure accurate and reproducible results across different experimental conditions:

  • Buffer Optimization

    • pH Range Testing: Systematically evaluate enzyme activity across pH 2.5-10.0 using appropriate buffers for each range:

      • Citrate (pH 2.5-5.5)

      • Carbonate (pH 5.3-7.3)

      • Phosphate (pH 6.2-8.2)

      • Tris (pH 7.5-9.0)

      • Glycine (pH 8.8-10.0)

    • Buffer Composition: Test the effect of different ionic strengths (50-200 mM) and addition of stabilizing agents such as glycerol (5-10%)

    • Manganese Supplementation: Include varying concentrations of Mn²⁺ (0.1-5 mM) given its critical role in D. geothermalis metabolism

  • Temperature Optimization

    • Temperature Range: Test activity at temperatures ranging from 30°C to 65°C to determine the optimum for the thermophilic enzyme

    • Thermal Stability: Evaluate enzyme stability by pre-incubating at different temperatures for various durations before activity measurement

    • Temperature Ramping: Consider continuous temperature ramping experiments to identify transitional temperature points

  • Substrate Parameter Optimization

    • Electron Donor Concentration: Optimize NADH and NADPH concentrations (10-500 μM) based on expected Km values (17-258 μM range)

    • Electron Acceptor Selection: Test multiple electron acceptors with varying concentrations:

      • 1,4-Benzoquinone (10-500 μM)

      • Coenzyme Q1 (10-500 μM)

      • DCPIP (10-500 μM)

      • Potassium ferricyanide (0.1-5 mM)

      • Ferrocenium hexafluorophosphate (0.1-5 mM)

    • Oxygen Sensitivity: Evaluate activity under aerobic vs. microaerobic conditions given D. geothermalis' ability to grow in varying oxygen environments

  • Detection Method Optimization

    • Spectrophotometric Parameters: Optimize wavelength, pathlength, and measurement intervals for different electron acceptors:

      • NADH oxidation (340 nm)

      • DCPIP reduction (600 nm)

      • Ferricyanide reduction (420 nm)

    • Reaction Kinetics: Determine optimal time course for measurements (initial rates vs. extended reactions)

    • Sensitivity Enhancement: Implement coupled enzyme assays where appropriate to amplify signal

  • Data Analysis Optimization

    • Kinetic Models: Apply appropriate kinetic models beyond Michaelis-Menten when necessary (substrate inhibition, allosteric effects)

    • Statistical Approach: Implement robust statistical methods for data analysis, potentially using the Solomon 4-Group Design to control for experimental artifacts

    • Normalization Methods: Standardize activity measurements against protein concentration, cofactor content, or internal standards

Table 1: Recommended Starting Conditions for D. geothermalis NADH-quinone oxidoreductase Activity Assays

ParameterBasic ConditionAdvanced Optimization Range
pH7.4 (MOPS buffer)6.5-8.5 in 0.5 increments
Temperature50°C30-65°C in 5°C increments
NADH200 μM50-500 μM
NADPH400 μM100-1000 μM
Electron AcceptorCoenzyme Q1 (100 μM)25-500 μM
Mn²⁺1 mM0-5 mM
Protein Concentration50 μg/mL10-200 μg/mL
Measurement Time5 minutes1-30 minutes

When optimizing assays, researchers should implement proper experimental design notation to clearly document the conditions and enable reproducibility . Each optimization parameter should be treated as an independent variable in a factorial design to identify not only optimal individual conditions but also important interactions between parameters.

What are promising research areas for investigating the role of nuoK in D. geothermalis' unique stress response mechanisms?

Several promising research directions can advance our understanding of nuoK's role in D. geothermalis' exceptional stress response mechanisms:

  • Radiation Response Integration

    • Investigate how nuoK contributes to maintaining respiratory chain function during and after radiation exposure

    • Develop experimental systems combining controlled irradiation with real-time measurements of NADH-quinone oxidoreductase activity

    • Compare wild-type and mutant versions of nuoK to identify radiation-responsive regions

    • Explore potential post-translational modifications of nuoK induced by radiation stress

  • Manganese-Dependent Regulation

    • Elucidate the molecular mechanism by which manganese availability affects NADH-quinone oxidoreductase activity

    • Investigate potential direct binding of manganese to the NADH-quinone oxidoreductase complex

    • Map the signaling pathways connecting manganese levels to respiratory chain regulation

    • Determine if nuoK undergoes structural changes in response to manganese availability

  • ROS Sensing and Response

    • Examine if nuoK or the NADH-quinone oxidoreductase complex directly senses ROS levels

    • Investigate how electron flow through the complex is modulated under oxidative stress

    • Determine whether specific residues in nuoK act as redox sensors

    • Study potential interactions between nuoK and dedicated ROS-combating systems

  • Metabolic Integration

    • Map how nuoK activity is coordinated with the shift from NADH to NADPH generation under stress

    • Investigate the relationship between succinate production pathways and NADH-quinone oxidoreductase function

    • Develop metabolic flux analysis methods to track electron flow through different pathways during stress response

    • Examine how nuoK activity influences carbon allocation between growth and stress resistance

  • Interspecies Comparative Analysis

    • Compare nuoK sequence, structure, and function across Deinococcus species with varying stress resistance

    • Conduct evolutionary analysis to identify positively selected residues that may contribute to extremophile adaptations

    • Create chimeric proteins incorporating domains from different species to map functional regions

    • Develop a systematic classification of nuoK adaptations across the extremophile spectrum

How might structural studies of nuoK contribute to designing radiation-resistant electron transport systems for biotechnological applications?

Structural studies of D. geothermalis nuoK offer significant potential for designing radiation-resistant electron transport systems with diverse biotechnological applications:

  • High-Resolution Structural Determination

    • Approach: Apply cryo-electron microscopy, X-ray crystallography, or NMR spectroscopy to determine the three-dimensional structure of nuoK within the NADH-quinone oxidoreductase complex

    • Application: Identify structural features that contribute to radiation resistance, including:

      • Unique folding patterns that shield sensitive cofactors

      • Distribution of aromatic residues that may absorb radiation energy

      • Specialized metal coordination sites that stabilize the protein during radiation exposure

    • Design Principle: Map radiation-resistant motifs that could be incorporated into synthetic electron transport components

  • Protein Dynamics Under Radiation

    • Approach: Develop specialized structural biology techniques to capture conformational changes during and after radiation exposure

    • Application: Understand how nuoK maintains structural integrity during radiation events

    • Design Principle: Engineer flexible regions and rigid cores in synthetic systems to allow radiation damage to occur in non-critical areas while preserving essential functional domains

  • Interface Mapping

    • Approach: Characterize the interfaces between nuoK and neighboring subunits using cross-linking mass spectrometry and molecular modeling

    • Application: Identify interaction networks that contribute to complex stability under radiation stress

    • Design Principle: Develop enhanced subunit interfaces for synthetic electron transport systems that resist radiation-induced dissociation

  • Cofactor Environment Analysis

    • Approach: Determine the precise environment surrounding electron transfer cofactors in nuoK and associated subunits

    • Application: Understand how D. geothermalis protects critical redox centers from radiation-induced damage

    • Design Principle: Create specialized cofactor pockets in engineered proteins that minimize radiation-induced oxidation

  • Membrane Interaction Characterization

    • Approach: Map the membrane-protein interface of nuoK using specialized lipid-protein interaction assays

    • Application: Understand how membrane embedding contributes to radiation resistance

    • Design Principle: Develop optimized transmembrane domains for synthetic electron transport components that maintain membrane integrity during radiation exposure

Biotechnological Applications:

The structural insights gained from these studies could enable development of:

  • Radiation-Resistant Biofuel Cells: Engineered electron transport components that continue to function in high-radiation environments, potentially for space applications or nuclear remediation sites

  • Long-Lived Biosensors: Radiation-hardened electrochemical biosensors for continuous monitoring in radiation-exposed environments

  • Bioremediation Systems: Engineered microorganisms with enhanced electron transport systems for nuclear waste bioremediation, incorporating nuoK-inspired design principles to maintain metabolic activity in contaminated sites

  • Extremophile-Inspired Nanotechnology: Biomimetic electron transport nanostructures that incorporate the radiation-resistant features identified in D. geothermalis nuoK

When designing experimental approaches for these structural studies, researchers should implement rigorous experimental design principles , including appropriate controls and statistical validation to ensure that structural features attributed to radiation resistance are genuinely causal rather than merely correlative.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.