Recombinant Deinococcus geothermalis Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Overview of Deinococcus geothermalis

Deinococcus geothermalis is a remarkable extremophile bacterium distinguished by its extraordinary resistance to multiple environmental stressors. As a member of the Deinococcus genus, it shares numerous characteristics with the well-studied Deinococcus radiodurans while exhibiting several unique properties.

Distinctive Characteristics and Habitat

D. geothermalis is a moderate thermophile with an optimal growth temperature of 50°C, setting it apart from most members of the Deinococcus genus . Unlike many of its relatives, D. geothermalis does not require exogenous sources of amino acids or nicotinamide for growth, demonstrating greater metabolic independence . The bacterium possesses the ability to form biofilms, which likely contributes to its survival in harsh environments . Additionally, D. geothermalis contains membranes with very low levels of unsaturated fatty acids compared to other Deinococcus species, a feature that may enhance its thermotolerance .

Extremophile Properties

The most notable characteristic of D. geothermalis is its extraordinary resistance to radiation, ultraviolet light, and desiccation, comparable to that of D. radiodurans at its optimal growth temperature . This exceptional resistance has made D. geothermalis an organism of significant interest for understanding the mechanisms behind radiation resistance in bacteria. Studies have indicated that this resistance is not due to unique DNA repair systems but rather to a collection of diverse "cell-cleaning systems" that have been accumulated from various sources during evolution .

Bioremediation Potential

Both D. geothermalis and D. radiodurans have demonstrated the ability to reduce various metals, including U(VI), Cr(VI), Hg(II), Tc(VII), Fe(III), and Mn(III,IV) . This capacity for metal reduction has led to proposals for using these bacteria in bioremediation of radioactive waste sites maintained by the US Department of Energy . The combination of extreme resistance and metal-reducing capabilities makes D. geothermalis particularly valuable for applications in contaminated environments.

Genomic Context of crcB2 in Deinococcus geothermalis

The genomic analysis of D. geothermalis provides critical context for understanding the crcB2, though specific information about this gene's function within the organism is limited in the available literature.

Genome Structure and Evolution

D. geothermalis possesses a complex genome consisting of a main chromosome and two megaplasmids . The genome contains numerous insertion sequences (ISs), with 93 total transposases in 73 full-length ISs distributed across the chromosome and megaplasmids . These insertion sequences contribute significantly to the genome plasticity of D. geothermalis and have played a role in its evolutionary adaptation .

Comparative Genomics

Comparative genomic analyses between D. geothermalis and D. radiodurans have revealed both conserved and divergent gene sets. While many genes implicated in radiation resistance are conserved between the two species, D. geothermalis has a greater abundance of genes for sugar metabolism enzymes, particularly those involved in xylose utilization . This reflects D. geothermalis' saccharolytic lifestyle, contrasting with the proteolytic lifestyle of D. radiodurans .

Gene Location and Context

The crcB2 gene in D. geothermalis is identified by the ordered locus name Dgeo_2546 . While specific information about the genomic neighborhood of crcB2 is limited in the available literature, understanding its context could provide insights into its functional relationships and regulatory mechanisms.

Physical and Chemical Properties

Table 1: Physical and Chemical Properties of Recombinant D. geothermalis crcB2 Protein

PropertyValueSource
UniProt AccessionQ1J3F4
Gene NamecrcB2
Locus NameDgeo_2546
Expression Region1-131
Sequence Length131 amino acids
OrganismDeinococcus geothermalis (strain DSM 11300)

General Function of CrcB Proteins

CrcB proteins typically function as fluoride ion channels or transporters in bacteria. These proteins play a critical role in fluoride resistance by exporting toxic fluoride ions from the cell interior to the extracellular environment, thereby maintaining cellular ion homeostasis. This function is particularly important in extremophile organisms that must maintain precise internal conditions despite harsh external environments.

Potential Role in Deinococcus geothermalis

Given the extreme environments in which D. geothermalis thrives, the crcB2 protein likely contributes to the organism's remarkable resilience. As a potential ion transporter, it may help maintain ionic balance under conditions of radiation stress, temperature fluctuations, or desiccation. The presence of this protein could be part of the complex cellular machinery that enables D. geothermalis to survive in conditions lethal to most other organisms.

Evolutionary Conservation

The conservation of crcB genes across bacterial species suggests their fundamental importance in bacterial physiology. In D. geothermalis, the presence of a crcB homolog indicates that fluoride resistance mechanisms are maintained even in environments where fluoride exposure might not be the primary stressor, pointing to possible additional or complementary functions of this protein.

Research Applications

Recombinant crcB2 protein can serve as a valuable tool in studies investigating membrane protein function, ion transport mechanisms, and bacterial stress responses. Research applications may include:

  1. Structural studies to elucidate the three-dimensional conformation of the protein

  2. Functional assays to determine specific ion transport capabilities

  3. Comparative studies with CrcB proteins from other extremophiles

  4. Investigations into the role of crcB2 in radiation and desiccation resistance

Production Process

The recombinant protein production process involves expression of the crcB2 gene in a suitable host system, followed by purification and quality control testing. The tag type for the recombinant protein is determined during the production process to optimize expression and purification . This approach ensures the production of a functionally active protein that accurately represents the native crcB2 of D. geothermalis.

Comparison with Related Proteins

Understanding the relationships between crcB2 and similar proteins provides context for its evolutionary history and functional significance.

Comparison with Other CrcB Homologs

Table 2: Comparison of D. geothermalis crcB2 with Related Proteins

FeatureD. geothermalis crcB2CrcB Proteins in Other Bacteria
Typical Length131 amino acids120-140 amino acids
FunctionPresumed ion transportFluoride ion export
Cellular LocationMembrane-associatedMembrane-integrated
Evolutionary ConservationPresent in extremophilesWidely distributed across bacterial phyla

Relationship to Radiation Resistance

While crcB2 is not specifically mentioned in the Radiation/Desiccation Response (RDR) regulon identified in comparative studies of D. radiodurans and D. geothermalis , membrane proteins play critical roles in maintaining cellular integrity during stress responses. The potential contribution of crcB2 to the extremophile phenotype merits further investigation, particularly regarding ion homeostasis during radiation exposure and recovery.

Future Research Directions

Future studies on D. geothermalis crcB2 protein could significantly enhance our understanding of bacterial resistance mechanisms and membrane protein functions.

Functional Characterization

Knockout studies, protein-protein interaction analyses, and ion transport assays would help define the precise role of crcB2 in D. geothermalis physiology and stress responses. Particular attention should be paid to its potential role in radiation resistance and adaptation to high-temperature environments.

Biotechnological Applications

Investigating the potential of crcB2 in biotechnological applications, particularly in bioremediation of metal-contaminated sites or development of radiation-resistant bioprocesses, represents a promising avenue for applied research.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
crcB2; Dgeo_2546; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Deinococcus geothermalis (strain DSM 11300)
Target Names
crcB2
Target Protein Sequence
MPFWFGVAVGGALGALARYGVSLLVAGRLASTAWGNFPLATLLVNVLGSFLLAFITTLAL RGLVSPAWRLAVGTGFIGALTTFSTFAWESDLMVRDGEAARASLYVLGNLVLGYAAVLLG RALAARLGGGA
Uniprot No.

Target Background

Function
Crucial for reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does crcB2 contribute to fluoride resistance in bacteria?

CrcB2 contributes to fluoride resistance through three primary mechanisms:

  • Fluoride ion export: The protein forms a selective membrane channel that exports cytoplasmic fluoride ions to the extracellular environment, maintaining low intracellular fluoride concentrations.

  • Integration with fluoride-sensing systems: CrcB2 expression is typically regulated by fluoride-responsive elements, particularly F- riboswitches, which detect elevated intracellular fluoride and upregulate channel expression .

  • Cooperative function: In many bacterial species, crcB proteins often function cooperatively with other fluoride channels. For example, in Streptococcus sanguinis, both crcB1 and crcB2 are crucial for fluoride resistance, while neither contributes individually to the extent that both do together .

Research has demonstrated that the deletion of crcB genes typically results in significantly increased fluoride sensitivity, confirming their critical role in bacterial fluoride resistance mechanisms .

What is the structural organization of the crcB operon in Deinococcus geothermalis?

The crcB operon in Deinococcus geothermalis typically contains:

  • A transcriptional F- riboswitch: A regulatory RNA element that binds fluoride ions and controls the expression of downstream genes.

  • crcB1 gene: Encodes the CrcB1 protein.

  • crcB2 gene: Encodes the CrcB2 protein (Dgeo_2546) .

This operon structure is common across various bacterial species but with notable variations. For instance, while Deinococcus geothermalis contains both crcB1 and crcB2 with associated F- riboswitches, some Acetobacterium species show differences: A. woodii lacks identifiable F- riboswitches, and A. fimetarium contains a truncated crcB2 gene .

The organization of these genes in an operon structure allows for coordinated expression in response to environmental fluoride levels, enabling efficient adaptation to changing conditions.

How does the function of crcB2 in Deinococcus geothermalis compare to crcB homologs in other bacterial species?

Comparative functional analysis reveals both conservation and specialization of crcB proteins across bacterial species:

Bacterial SpeciescrcB HomologsFluoride Resistance MechanismNotable Characteristics
Deinococcus geothermaliscrcB1, crcB2Both proteins likely contribute to fluoride resistanceExtremophile adapted to high temperatures and radiation
Streptococcus mutans (Group I)Only eriC1EriC1 channels predominantly affect fluoride resistanceNo functional crcB homologs identified
Streptococcus anginosus (Group II)eriC1, eriC2EriC1 responsible for fluoride resistance, eriC2 not involvedComplementary system to crcB
Streptococcus sanguinis (Group III)eriC2, crcB1, crcB2Both crcB1 and crcB2 crucial, eriC2 not involvedRequires both crcBs for optimal resistance

In S. sanguinis, the deletion of either crcB1 or crcB2 significantly reduces fluoride resistance, indicating that both proteins are required for optimal function. Interestingly, complementation experiments between S. mutans EriC1 and S. sanguinis CrcB1/CrcB2 demonstrated functional substitution, suggesting a conserved mechanistic role despite sequence differences .

What methodologies are most effective for studying crcB2 channel activity?

Researchers investigating crcB2 channel activity typically employ multiple complementary approaches:

  • Fluoride-sensitive growth assays:

    • Bacterial strains expressing or lacking crcB2 are grown in media containing varying fluoride concentrations.

    • Growth rates and survival curves are measured to quantify fluoride resistance.

    • Example protocol: Cultures are grown to mid-log phase, diluted to OD600 of 0.1, and exposed to 0-10 mM NaF with growth monitored over 24 hours.

  • Genetic knockout and complementation studies:

    • The crcB2 gene is deleted using homologous recombination techniques.

    • The aminoglycoside 3'-phosphotransferase (kan) gene with 50 bp homology arms of crcB can be amplified from plasmids like pKD4 for targeted gene replacement .

    • Complementation with wild-type crcB2 confirms phenotype specificity.

  • Fluoride transport assays:

    • Fluoride-specific electrodes measure ion flux across membranes.

    • Fluorescent indicators such as SBFI (sodium-binding benzofuran isophthalate) modified for fluoride sensitivity can monitor real-time transport.

    • Radioisotope (18F) flux measurements provide quantitative transport data.

  • Electrophysiological approaches:

    • Patch-clamp techniques applied to bacterial spheroplasts or reconstituted liposomes.

    • Planar lipid bilayer recordings with purified crcB2 protein.

    • Measuring current-voltage relationships under varying fluoride concentrations.

Combining these methodologies provides comprehensive insights into crcB2 channel kinetics, selectivity, and regulatory mechanisms .

How does environmental stress influence crcB2 expression and function in Deinococcus geothermalis?

Deinococcus geothermalis thrives in environments characterized by multiple stressors including radiation, temperature extremes, desiccation, and potentially high mineral content (including fluoride). The regulation of crcB2 expression appears integrated with broader stress response mechanisms:

  • Oxidative stress response:

    • D. geothermalis employs specialized carbon metabolism pathways that generate NADPH rather than NADH to combat reactive oxygen species (ROS) .

    • The expression of crcB2 may be coordinated with these pathways to maintain membrane integrity during oxidative stress.

  • Metabolic adaptation:

    • During transition from growth to non-growth phases, D. geothermalis downregulates oxidative phosphorylation, affecting membrane potential .

    • As an ion channel, crcB2 function is likely influenced by these changes in membrane potential, suggesting coordinated regulation.

  • F- riboswitch-mediated regulation:

    • The presence of fluoride-responsive riboswitches in the crcB operon indicates a specific regulatory mechanism responsive to environmental fluoride .

    • Under high fluoride conditions, these riboswitches activate expression of crcB genes to enhance fluoride export capacity.

Proteomic studies of D. geothermalis under various stress conditions have identified 165 proteins whose expression changes during growth phase transitions, suggesting complex regulatory networks that may include crcB2 . Future research specifically examining crcB2 expression under combined stress conditions would provide valuable insights into its role in extremophile adaptation.

What are optimal protocols for expression and purification of recombinant Deinococcus geothermalis crcB2?

Recommended Expression Protocol:

  • Expression system selection:

    • E. coli BL21(DE3) is preferred for initial expression attempts.

    • For membrane proteins like crcB2, C41(DE3) or C43(DE3) strains often yield better results.

    • Expression vector should include a promoter with tunable expression levels (T7-lac or arabinose-inducible systems).

  • Construct design:

    • Include the full 131-amino acid sequence of crcB2 .

    • Add a purification tag (His6, FLAG, or Strep-tag II) at either N- or C-terminus.

    • For structural studies, consider fusion partners like GFP to monitor folding.

  • Culture conditions:

    • Growth at lower temperatures (16-25°C) after induction improves membrane protein folding.

    • Use rich media supplemented with glucose for initial growth, switching to induction media containing appropriate inducer.

    • Addition of membrane-stabilizing compounds (glycerol 5-10%) may improve yield.

Purification Protocol:

  • Membrane extraction:

    • Harvest cells and disrupt by sonication or high-pressure homogenization.

    • Isolate membranes by ultracentrifugation (100,000 × g, 1 hour).

    • Solubilize membranes using detergents (recommended: n-dodecyl-β-D-maltopyranoside (DDM) at 1-2%).

  • Affinity purification:

    • Apply solubilized protein to appropriate affinity resin.

    • Wash extensively with detergent-containing buffer to remove non-specific binding.

    • Elute with competitive ligand or pH change as appropriate for the tag.

  • Size exclusion chromatography:

    • Further purify by gel filtration to isolate properly folded, monodisperse protein.

    • Analyze fractions by SDS-PAGE to confirm purity.

  • Storage:

    • Store purified crcB2 in Tris-based buffer with 50% glycerol at -20°C.

    • For extended storage, maintain at -80°C.

    • Avoid repeated freeze-thaw cycles; prepare working aliquots for 4°C storage for up to one week .

How can researchers effectively evaluate crcB2 fluoride transport activity?

Fluoride Transport Assay Protocol:

  • Preparation of crcB2-containing proteoliposomes:

    • Mix purified crcB2 with synthetic lipids (e.g., POPC:POPE, 3:1) and detergent.

    • Remove detergent via dialysis or Bio-Beads to form proteoliposomes.

    • Load liposomes with buffer containing fluoride-sensitive dye.

  • Transport measurement setup:

    • Suspend proteoliposomes in fluoride-free buffer.

    • Create fluoride gradient by adding NaF to external buffer.

    • Monitor fluorescence changes using plate reader or fluorometer.

  • Data collection and analysis:

    • Record time-course of fluorescence change.

    • Calculate initial rates of transport at different fluoride concentrations.

    • Determine Km and Vmax for fluoride transport.

    • Compare wild-type crcB2 with mutant variants.

Complementary Approaches:

  • Whole-cell fluoride sensitivity assays:

    • Transform crcB-knockout bacterial strains with crcB2 expression vectors.

    • Determine minimum inhibitory concentration (MIC) of fluoride.

    • Measure growth rates in varying fluoride concentrations.

  • Fluoride electrode measurements:

    • Direct measurement of fluoride concentration changes in buffer.

    • Provides absolute quantification of transport rates.

  • Patch-clamp electrophysiology:

    • For single-channel kinetics and conductance measurement.

    • Requires specialized equipment but provides detailed mechanistic information.

These approaches provide complementary data on crcB2 transport activity, from whole-cell phenotypes to detailed biophysical characterization .

How does crcB2 function compare to other fluoride resistance mechanisms in bacteria?

Bacteria have evolved multiple mechanisms for fluoride resistance, with crcB2 representing one component of these systems. Comparative analysis reveals:

MechanismProtein FamilyFunctionDistributionRegulation
CrcB channelsCrcB familyF- exportWidespread across bacteriaTypically regulated by F- riboswitches
EriC channelsCLC familyF- exportFound in many bacteria including oral streptococciVariable regulation mechanisms
FEX transportersFEX familyF- exportPresent in eukaryotes and some prokaryotesNot typically associated with F- riboswitches
Enzymatic detoxificationVariousConverts F- to less toxic formsLimited distributionMultiple regulatory pathways

Research on oral streptococci has identified three distinct patterns of fluoride resistance gene distribution:

  • Group I (e.g., S. mutans): Contains only eriC1

  • Group II (e.g., S. anginosus): Contains eriC1 and eriC2

  • Group III (e.g., S. sanguinis): Contains eriC2, crcB1, and crcB2

Interestingly, in Group III species, both crcB1 and crcB2 are required for fluoride resistance, while eriC2 does not contribute significantly. This suggests functional specialization among fluoride channels, with crcB proteins potentially adapted for specific environmental niches .

What bioinformatic approaches are most valuable for analyzing crcB2 sequence-structure-function relationships?

To thoroughly analyze crcB2 sequence-structure-function relationships, researchers should employ an integrated bioinformatics pipeline:

  • Sequence analysis and conservation:

    • Multiple sequence alignment of crcB homologs across diverse bacterial species.

    • Conservation analysis to identify functionally critical residues.

    • Tools: MUSCLE, MAFFT, ConSurf server.

  • Transmembrane topology prediction:

    • Prediction of membrane-spanning regions and orientation.

    • Tools: TMHMM, Phobius, TOPCONS.

    • For crcB2, analysis typically reveals multiple transmembrane domains consistent with channel function.

  • Structural modeling:

    • For crcB2, which lacks experimental structural data, homology modeling based on related proteins.

    • Tools: I-TASSER, SWISS-MODEL, AlphaFold2.

    • Molecular dynamics simulations to predict conformational dynamics.

  • Functional site prediction:

    • Identification of potential fluoride binding sites and channel pore residues.

    • Tools: CASTp, DEPTH, ConCavity.

    • Docking simulations with fluoride ions to predict interaction mechanisms.

  • Evolutionary analysis:

    • Phylogenetic reconstruction of crcB protein family evolution.

    • Detection of potential selection signatures using dN/dS ratio analysis.

    • Correlation of evolutionary patterns with environmental adaptation.

  • Genomic context analysis:

    • Examination of crcB operon structure across species.

    • Identification of F- riboswitch elements and their conservation.

    • Determination of co-evolved gene clusters.

Implementing this bioinformatics pipeline provides a comprehensive framework for generating hypotheses about crcB2 function that can be tested experimentally through site-directed mutagenesis and functional assays .

What are the potential applications of crcB2 research in environmental bioremediation?

Research on crcB2 and related fluoride transport systems has significant potential applications in environmental bioremediation, particularly in addressing fluoride contamination:

  • Engineered bioremediation systems:

    • Bacteria expressing optimized crcB2 variants could potentially be used for fluoride bioaccumulation from contaminated water sources.

    • Mathematical modeling based on known transport kinetics suggests that a biofilm of crcB2-expressing bacteria could theoretically process up to 5-10 mg/L of fluoride in continuous flow systems.

  • Biosensors for environmental monitoring:

    • F- riboswitch elements associated with crcB genes can be adapted as fluoride-specific biosensors.

    • Reporter gene constructs linked to these riboswitches could enable real-time monitoring of environmental fluoride levels.

  • Industrial wastewater treatment:

    • Industries producing fluoride-rich wastewater (semiconductor manufacturing, aluminum production) could benefit from biological treatment systems.

    • D. geothermalis is particularly suited for industrial applications due to its resistance to multiple stressors, including temperature and oxidative stress .

  • Design principles for synthetic biology:

    • Understanding the structure-function relationship of crcB2 provides design principles for creating synthetic fluoride transport systems.

    • Potential applications include creating bacterial strains with enhanced or selective ion transport capabilities.

  • Adaptation to fluoride-rich environments:

    • Research on how crcB2 contributes to D. geothermalis' survival in fluoride-rich environments provides insights for developing strategies to remediate sites with multiple contaminants.

    • The extremophilic nature of D. geothermalis makes it a promising platform for developing robust bioremediation systems .

The implementation of crcB2-based technologies would require careful optimization of expression levels, assessment of potential ecological impacts, and integration with existing water treatment technologies. Future research focusing on enhancing transport efficiency and selectivity could significantly advance these applications.

What are the critical knowledge gaps in understanding crcB2 function and regulation?

Despite progress in identifying and characterizing crcB proteins, several critical knowledge gaps remain:

  • Structural determinants of fluoride selectivity:

    • The precise atomic structure of crcB2 remains undetermined.

    • Research should focus on crystallography or cryo-EM studies to resolve channel architecture.

    • Structure-guided mutagenesis could identify key residues for fluoride recognition and transport.

  • Regulatory network complexity:

    • While F- riboswitches are known to regulate crcB expression, the interaction with broader stress response networks remains poorly understood.

    • Transcriptomic and proteomic studies under varied stress conditions would clarify how crcB2 regulation integrates with other cellular processes in D. geothermalis .

  • Transport mechanisms and energetics:

    • The precise mechanism of fluoride transport (passive channel vs. active transport) requires clarification.

    • Biophysical studies examining ion selectivity, conductance, and gating mechanisms would address this gap.

  • Evolutionary adaptation:

    • How has crcB2 evolved in extremophiles like D. geothermalis compared to mesophilic bacteria?

    • Comparative genomics and directed evolution experiments could reveal adaptation mechanisms.

  • Interactions with membrane components:

    • The lipid environment likely influences crcB2 function, but specific lipid-protein interactions remain uncharacterized.

    • Lipidomic analysis coupled with functional assays in defined membrane compositions would address this gap.

  • Potential for heteromeric channels:

    • Whether crcB1 and crcB2 form heteromeric channels or function independently in species containing both genes.

    • Co-immunoprecipitation and crosslinking studies could clarify physical interactions between channel components.

Addressing these knowledge gaps would significantly advance understanding of bacterial fluoride resistance mechanisms and potentially enable biotechnological applications of crcB2 and related proteins .

What experimental approaches could advance crcB2 research in the next five years?

Several cutting-edge experimental approaches show promise for advancing crcB2 research:

  • Cryo-electron microscopy:

    • Single-particle cryo-EM has revolutionized membrane protein structural biology.

    • Application to crcB2 could resolve channel structure at near-atomic resolution.

    • Visualization of different conformational states would elucidate transport mechanism.

  • Advanced fluoride sensing techniques:

    • Development of improved fluoride-sensitive fluorescent probes.

    • Application of these probes in combination with super-resolution microscopy to visualize fluoride flux in real-time.

  • High-throughput mutagenesis and functional screening:

    • CRISPR-based saturation mutagenesis of crcB2.

    • Coupling with fluoride sensitivity assays to comprehensively map structure-function relationships.

  • Single-molecule fluorescence techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes during transport.

    • Single-molecule tracking to determine membrane dynamics and clustering behavior.

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to place crcB2 function in broader cellular context.

    • Network analysis to identify coordination with other stress response systems.

  • Directed evolution methodologies:

    • Development of crcB2 variants with enhanced transport properties through laboratory evolution.

    • Selection under progressive fluoride stress to identify adaptive mutations.

  • Synthetic biology applications:

    • Creation of synthetic fluoride-responsive genetic circuits incorporating F- riboswitches and crcB genes.

    • Engineering of bacterial consortia with enhanced fluoride bioremediation capacity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.