Recombinant Deinococcus radiodurans C4-dicarboxylate transport protein (dctA)

Shipped with Ice Packs
In Stock

Description

Introduction to Deinococcus radiodurans

Deinococcus radiodurans is one of the most radioresistant organisms known, demonstrating an exceptional ability to survive exposure to DNA-damaging agents, particularly very high doses of ionizing radiation . This bacterium can reconstruct a functional genome from hundreds of radiation-induced chromosomal fragments, making it a subject of significant scientific interest . Its remarkable resilience is attributed to various specialized proteins and repair mechanisms, with the RecA protein being essential for its extreme radiation resistance . The organism contains a multipartite genome system with all molecules packaged in a highly compact, doughnut-shaped toroidal nucleoid structure .

The extraordinary resistance capabilities of D. radiodurans have made it a candidate for various biotechnological applications, including engineered strains for bioremediation of mixed wastes containing both radionuclides and organic pollutants . Understanding the transport mechanisms that sustain this organism under extreme conditions is crucial to harnessing its full potential.

Overview of C4-Dicarboxylate Transport

C4-dicarboxylates, including succinate, fumarate, malate, and oxaloacetate, are key intermediates in the tricarboxylic acid (TCA) cycle and serve as important carbon and energy sources for many bacteria . The transport of these compounds across bacterial membranes is facilitated by specialized transporters belonging to different families.

In bacterial systems, C4-dicarboxylate transport has been extensively studied, revealing several distinct transport mechanisms:

Transport SystemFamilyTransport MechanismAffinityOrganisms
DctADAACS (Dicarboxylate/Amino Acid:Cation Symporter)Proton-coupled symportHigh affinity at high concentrationsWidely distributed in bacteria
DctPQMTRAP (Tripartite ATP-independent Periplasmic)Proton-coupled transportHigh affinity at low concentrationsPseudomonas, Rhodobacter

DctA Transport Mechanism

The DctA protein has been characterized as a secondary transporter that mediates ion-coupled uptake of C4-dicarboxylates . Biochemical studies have determined that DctA catalyzes proton-coupled symport of the four C4-dicarboxylates from the Krebs cycle (succinate, fumarate, malate, and oxaloacetate) but not other mono- and dicarboxylates .

The transport process facilitated by DctA has been found to be electrogenic, stimulated by an internal negative membrane potential, and the transporter recognizes the divalent anionic form of the substrates . Research indicates that at least three protons must be cotransported with each succinate molecule, highlighting the energetic investment required for this nutrient acquisition mechanism .

Genomic Context

In D. radiodurans, the dctA gene (DR_2525) encodes the C4-dicarboxylate transport protein . This protein is part of the metabolic network that contributes to the organism's carbon utilization capabilities. The genomic organization of dctA in D. radiodurans is integrated within its complex regulatory networks, which enable the bacterium to adapt to various environmental stresses.

Functional Role in D. radiodurans Metabolism

DctA plays a critical role in the carbon metabolism of D. radiodurans by facilitating the uptake of C4-dicarboxylates, which serve as carbon and energy sources. These compounds feed into the TCA cycle, providing intermediates for various biosynthetic pathways and energy generation.

Research suggests that malate-dependent carbon utilization enhances central metabolism in bacteria, with DctA serving as a key transporter for malate uptake . This transport system contributes to the organism's metabolic flexibility, potentially supporting its survival under nutrient-limited conditions.

Expression Systems

Recombinant D. radiodurans DctA can be produced using various expression systems, including bacterial hosts such as Escherichia coli, yeast, baculovirus, or mammalian cell systems . The choice of expression system depends on the specific requirements for protein folding, post-translational modifications, and functional activity.

For research purposes, the recombinant protein is typically produced with high purity (>90%) and may include tags for purification or detection . The protein is generally stored in a liquid form containing glycerol to maintain stability during storage at -20°C or -80°C .

Purification and Characterization

The purification of recombinant DctA typically involves multiple chromatographic steps to achieve high purity. Due to its hydrophobic nature as a membrane protein, specialized detergents or amphipathic compounds may be required during the purification process to maintain protein stability and functionality.

Characterization of the recombinant protein includes:

  1. Biochemical assays to determine substrate specificity

  2. Transport assays using membrane vesicles to assess functional activity

  3. Structural studies to understand the protein's conformation

  4. Mutational analyses to identify key residues involved in transport

Research Applications

Recombinant D. radiodurans DctA serves as a valuable tool for studying:

  1. Membrane transport mechanisms in extremophiles

  2. Structure-function relationships in secondary transporters

  3. Metabolic adaptations that contribute to extreme resistance phenotypes

  4. Comparative analyses with DctA proteins from other bacterial species

Biotechnological Applications

The unique properties of D. radiodurans and its proteins have attracted interest for various biotechnological applications:

  1. Bioremediation: Engineered D. radiodurans strains have been developed for bioremediation of mixed wastes containing both radionuclides and organic solvents . The DctA transporter could potentially contribute to carbon source utilization in such applications.

  2. Protein Engineering: Understanding the structure and function of DctA provides insights for engineering transport proteins with enhanced specificity or efficiency.

  3. Biosensors: Transport proteins like DctA can be incorporated into biosensor systems for detecting specific metabolites.

  4. Metabolic Engineering: Manipulation of carbon transport systems, including DctA, could enhance substrate utilization in engineered strains for biotechnological processes.

Recent Findings

Recent research has expanded our understanding of transport proteins in D. radiodurans and their roles in the organism's remarkable resilience. Studies have identified differential expression of transport proteins, including DctA, under various stress conditions . For example, high vacuum exposure leads to upregulation of TCA cycle proteins and transporters in D. radiodurans .

The integration of transcriptomic and proteomic approaches has revealed that transport proteins are part of the complex regulatory networks that enable D. radiodurans to adapt to extreme conditions . These networks involve various transcription factors, including global regulators like CRP (cAMP receptor protein), which has been shown to control the expression of over 400 target genes in D. radiodurans .

Future Research Directions

Future research on recombinant D. radiodurans DctA may focus on:

  1. Detailed Structural Characterization: Advanced structural studies using techniques such as cryo-electron microscopy or X-ray crystallography to elucidate the three-dimensional structure of DctA.

  2. Transport Kinetics: Comprehensive analysis of transport kinetics under various conditions to understand how DctA functions under extreme environments.

  3. Regulatory Mechanisms: Investigation of the regulatory mechanisms controlling DctA expression in D. radiodurans, particularly in response to environmental stresses.

  4. Protein Engineering: Development of engineered variants of DctA with enhanced stability or altered substrate specificity for biotechnological applications.

  5. Integration in Synthetic Biology Applications: Incorporating DctA into synthetic metabolic pathways for enhanced carbon utilization in engineered microorganisms.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
dctA; DR_2525; C4-dicarboxylate transport protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Target Names
dctA
Target Protein Sequence
MPKIFRSLYVQVIIAIVLGILVGALFPKFGEALKPLGDIFVKLIKMVIAPIIFATVVSGV AHMRDTRKVGRVGGKALIYFEVVSTLALIIGMVVMNVLRPGAGMNVDPATLDTAGLTKYT EAAGEMTVWDHILKIIPDTLVSAFTGGELLPVLLVALLFGFALMRLGKLGDQILYGIDAL NQVVFVILGFIMRLAPIGAFGAMAFTVGKYGLKSLTSLGYLMGSFYLTCLLFIFVVLGLI ARAAGFSIFKLIRYIREELLIVLGTSSSESALPRLMMKLEHAGAEKSVVGLVVPTGYSFN LDGTSIYLTMAALFIAQATNTPLGLGEQLSLLAVLLLTSKGAAGVTGSGFITLAATLGAV GHVPVAGMALILGIDRFMSEARALTNFIGNAVATLVVARSENAVDMNRLTRALNGEDLPT TEPDVASEERGEGREIDSSRPVT
Uniprot No.

Target Background

Function
This protein is responsible for transporting dicarboxylates, such as succinate, fumarate, and malate, across cellular membranes.
Database Links

KEGG: dra:DR_2525

STRING: 243230.DR_2525

Protein Families
Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of DctA in Deinococcus radiodurans metabolism?

DctA in D. radiodurans, similar to its homologs in other bacteria, functions as a C4-dicarboxylate/H+ or Na+ cation symporter that catalyzes the uptake of C4-dicarboxylates during aerobic growth. This transporter is essential for the utilization of carbon sources such as aspartate, fumarate, and succinate under high oxygen conditions . Experimental evidence from comparable systems suggests that DctA is the primary transporter responsible for C4-dicarboxylate uptake during aerobic metabolism, as demonstrated by growth impairment in dctA mutants when these carbon sources are provided .

The metabolic significance of DctA becomes particularly relevant in D. radiodurans given the organism's need for efficient carbon utilization during recovery from extreme stress conditions, such as radiation exposure. Research methodologies to investigate this role should include comparative growth analysis of wild-type and dctA mutant strains under varying carbon source conditions, coupled with metabolite profiling to track C4-dicarboxylate utilization patterns.

How is DctA expression regulated in response to environmental conditions?

The regulation of DctA expression in D. radiodurans likely involves multiple mechanisms responding to oxygen levels, carbon source availability, and stress conditions. Based on studies in other bacterial systems, DctA expression is typically repressed under anaerobic conditions through regulatory systems such as the two-component ArcBA system . Additionally, carbon catabolite repression may occur through mechanisms involving cAMP-CRP complexes when preferred carbon sources like glucose are present .

To investigate DctA regulation in D. radiodurans specifically, researchers should employ qRT-PCR to measure dctA transcript levels under varying conditions, construct reporter gene fusions to monitor promoter activity, and perform chromatin immunoprecipitation to identify potential transcription factor binding sites. The unique regulatory mechanisms in D. radiodurans may differ from model organisms due to its specialized stress response systems.

What structural features distinguish D. radiodurans DctA from homologs in other bacteria?

While specific structural information for D. radiodurans DctA is limited in the provided research, comparative sequence analysis with DctA proteins from other bacteria would reveal conserved domains and unique features. Researchers should perform multiple sequence alignments and homology modeling based on available crystal structures of related transporters.

Methodologically, this question can be addressed through recombinant expression of D. radiodurans DctA, followed by purification and structural determination using X-ray crystallography or cryo-electron microscopy. Site-directed mutagenesis of predicted functional residues would help validate structural models and identify regions critical for substrate specificity or transport activity in the D. radiodurans variant.

What is the optimal protocol for expressing and purifying functional recombinant D. radiodurans DctA?

Expression and purification of functional membrane proteins like DctA present significant challenges. Researchers should consider several expression systems, including E. coli strains optimized for membrane protein expression (such as C41/C43 or Lemo21), with careful optimization of induction conditions to prevent formation of inclusion bodies.

The methodological approach should include:

  • Cloning the dctA gene with appropriate affinity tags (His6, FLAG, or Strep-tag II)

  • Testing expression in multiple host systems with varying induction parameters

  • Membrane fraction isolation followed by detergent screening (DDM, LMNG, or GDN) for optimal solubilization

  • Purification using affinity chromatography and size exclusion chromatography

  • Validation of protein folding and function through substrate binding assays

Researchers should incorporate controls by expressing well-characterized DctA homologs in parallel to benchmark purification efficiency and functional activity.

How can we establish a reliable in vitro transport assay for recombinant D. radiodurans DctA?

Developing a functional assay for DctA requires reconstitution of the purified protein into a membrane environment that allows measurement of transport activity. This can be accomplished through proteoliposome reconstitution or supported membrane systems.

The methodological workflow should include:

  • Reconstitution of purified DctA into liposomes composed of E. coli polar lipids or synthetic lipid mixtures

  • Loading proteoliposomes with buffer containing pH-sensitive or fluorescent indicators

  • Initiating transport by adding C4-dicarboxylate substrates externally

  • Monitoring transport through changes in internal pH, fluorescence, or radiolabeled substrate accumulation

Researchers should also consider substrate specificity determination by comparing transport rates of different C4-dicarboxylates (succinate, fumarate, malate, aspartate) and establishing kinetic parameters (Km, Vmax) for each substrate.

What experimental approaches can determine if DctA function is modified during D. radiodurans' response to radiation stress?

Given D. radiodurans' extraordinary radioresistance, investigating potential changes in DctA function during radiation response provides valuable insights into stress adaptation mechanisms. This requires integrated approaches combining transcriptomics, proteomics, and functional assays.

Methodologically, researchers should:

  • Expose D. radiodurans cultures to varying radiation doses and collect samples during recovery

  • Perform RNA-seq to measure dctA transcript levels during post-irradiation recovery

  • Use mass spectrometry to identify potential post-translational modifications of DctA protein

  • Assess DctA transport activity in membrane vesicles isolated from irradiated cells

  • Construct reporter strains with dctA promoter-luciferase fusions to monitor real-time expression changes

Particular attention should be given to potential phosphorylation events, as D. radiodurans employs phosphorylation to regulate key proteins during stress response, as demonstrated for RecA .

How does DctA function contribute to D. radiodurans' extreme radioresistance?

The relationship between DctA function and radioresistance represents a complex research question that requires systematic investigation. D. radiodurans' radioresistance depends on efficient DNA repair mechanisms, including RecA-mediated homologous recombination and extended synthesis-dependent strand annealing (ESDSA) .

Methodologically, researchers should:

  • Generate dctA knockout mutants and assess their survival following radiation exposure

  • Compare metabolomic profiles of wild-type and dctA mutants during post-irradiation recovery

  • Investigate whether C4-dicarboxylate metabolism influences production of reducing equivalents needed for antioxidant systems

  • Examine potential interactions between DctA and DNA repair proteins using co-immunoprecipitation or bacterial two-hybrid systems

  • Test whether overexpression of DctA enhances radioresistance in D. radiodurans or confers increased resistance when expressed in radiosensitive bacteria

Researchers should consider the broader metabolic context, as C4-dicarboxylate metabolism may influence energy production and redox homeostasis during recovery from radiation damage.

Is there evidence for post-translational modification of DctA during stress response in D. radiodurans?

D. radiodurans employs various regulatory mechanisms to control protein function during stress response. For instance, RecA undergoes phosphorylation at specific residues (Tyr-77 and Thr-318) by the RqkA kinase in response to DNA damage, which modifies its activity and enhances DNA repair capabilities .

To investigate potential post-translational modifications of DctA, researchers should:

  • Perform phosphoproteomic analysis of DctA isolated from D. radiodurans under normal and stress conditions

  • Identify putative modification sites through mass spectrometry

  • Generate site-specific mutants (replacing modifiable residues with non-modifiable alternatives) to assess functional consequences

  • Investigate kinases that might interact with DctA, potentially including RqkA

  • Compare transport activity of modified versus unmodified DctA in reconstitution systems

The methodological approach should include both in vivo analysis of DctA modifications and in vitro validation using recombinant proteins and purified kinases/modification enzymes.

How does DctA interact with the DNA damage response and repair machinery in D. radiodurans?

While direct interaction between DctA and DNA repair proteins might seem unlikely given their different cellular functions, metabolic processes regulated by DctA could indirectly influence DNA repair efficiency. In D. radiodurans, DNA repair depends on proteins like RecA, RecF, RecO, DprA, and DdrB .

To investigate potential connections, researchers should:

  • Perform transcriptomic analysis comparing wild-type and dctA mutants following radiation exposure

  • Use metabolic flux analysis to track carbon flow through central metabolism during DNA repair

  • Test whether C4-dicarboxylate availability affects expression or activity of DNA repair proteins

  • Investigate genetic interactions through construction of double mutants (dctA with various DNA repair genes)

  • Examine localization of DctA during normal growth and post-irradiation using fluorescent protein fusions

The methodological approach should be holistic, considering metabolic, transcriptional, and post-translational regulatory networks that might connect carbon metabolism to DNA repair processes.

How can researchers resolve contradictory findings between DctA function in D. radiodurans and other bacterial species?

When comparing DctA function across bacterial species, researchers may encounter contradictory results due to differences in experimental systems, genetic backgrounds, or environmental conditions. This is evident from comparing DctA function in E. coli versus C. jejuni, where regulatory mechanisms and physiological roles show both similarities and differences .

To address contradictory findings methodologically:

  • Standardize experimental conditions when comparing across species

  • Perform heterologous expression studies, expressing D. radiodurans DctA in other bacterial systems

  • Create chimeric proteins combining domains from different bacterial DctA homologs to identify species-specific functional regions

  • Use comparative genomics to analyze genetic context of dctA across species

  • Develop unified transport assays that can be applied consistently across different bacterial systems

Researchers should present data in comparative tables showing key parameters (substrate specificity, kinetic constants, regulation mechanisms) across different bacterial species to highlight genuine differences versus methodological artifacts.

What statistical approaches best analyze complex datasets from DctA functional studies?

Functional studies of DctA generate complex datasets, particularly when examining multiple substrates, conditions, and genetic backgrounds. Appropriate statistical analysis ensures robust interpretation of results.

Methodologically, researchers should:

  • Apply multivariate statistical methods (principal component analysis, hierarchical clustering) to identify patterns in transport activity across conditions

  • Use mixed-effects models when analyzing time-series data of substrate utilization

  • Implement Bayesian approaches for parameter estimation in kinetic modeling of transport

  • Perform power analysis to determine appropriate experimental replication

  • Validate findings through independent experimental approaches

For example, when comparing growth phenotypes of dctA mutants versus wild-type strains on different carbon sources, researchers should present data as shown in this example table:

Carbon SourceWild-type Growth Rate (h⁻¹)dctA Mutant Growth Rate (h⁻¹)Statistical SignificanceP-value
Aspartate0.42 ± 0.030.11 ± 0.02Yes<0.001
Fumarate0.38 ± 0.040.09 ± 0.02Yes<0.001
Succinate0.35 ± 0.030.08 ± 0.01Yes<0.001
Serine0.40 ± 0.050.38 ± 0.04No0.724

What novel experimental techniques could advance understanding of DctA structure-function relationships?

Emerging technologies offer new opportunities to investigate DctA structure and function at unprecedented resolution.

Methodologically, researchers should consider:

  • Applying cryo-electron microscopy to determine high-resolution structures of DctA in different conformational states

  • Using single-molecule FRET to monitor conformational changes during transport cycles

  • Implementing hydrogen-deuterium exchange mass spectrometry to identify dynamic regions and substrate binding sites

  • Developing in silico molecular dynamics simulations based on structural data to predict transport mechanisms

  • Applying CRISPR-based genome editing for precise manipulation of dctA and regulatory elements in D. radiodurans

These approaches should be combined with traditional biochemical and genetic methods to provide complementary insights into DctA function.

How can systems biology approaches integrate DctA function into broader metabolic networks of D. radiodurans?

Understanding DctA's role within the larger metabolic network of D. radiodurans requires systems-level approaches that capture complex interactions and regulatory mechanisms.

Methodologically, researchers should:

  • Develop genome-scale metabolic models incorporating C4-dicarboxylate transport and metabolism

  • Perform 13C metabolic flux analysis to quantify carbon flow through pathways connected to DctA function

  • Integrate transcriptomic, proteomic, and metabolomic data into multi-omics analyses

  • Apply network analysis to identify metabolic hubs and regulatory nodes connected to DctA

  • Develop predictive models of how perturbations in DctA function affect global metabolic homeostasis

This systems approach would help contextualize DctA's role during normal growth and stress response, particularly in relation to D. radiodurans' remarkable stress resistance capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.