Recombinant Deinococcus radiodurans Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Functional Role and Biological Context

While D. radiodurans is renowned for its DNA repair systems (e.g., ssb, ddrB) , cobalamin synthase is implicated in metabolic pathways supporting redox balance and energy production. Key observations:

  • Cobalamin Synthase Function: Catalyzes the final step of vitamin B12 synthesis, transferring adenosyl groups to cobalt-precorrin-2 .

  • Radiation Resistance Link: Indirect associations exist between cobalamin-dependent enzymes and antioxidant activity in Deinococcus species, though direct evidence for cobS in radiation tolerance is lacking .

Research Applications and Limitations

Current Uses:

  • Enzyme Kinetics: Study of transferase mechanisms in extremophiles .

  • Protein Engineering: Template for thermostable enzyme design due to D. radiodurans' resilience .

Challenges:

  • Partial Sequence: Limits structural and functional studies .

  • Underexplored Pathways: cobS’s role in D. radiodurans metabolism remains speculative compared to well-characterized proteins like RecA or DdrB .

Future Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography to map active sites.

  • Metabolic Profiling: Link cobS activity to manganese-antioxidant complexes in D. radiodurans .

  • Biotechnological Potential: Leverage radiation-hardy expression systems for industrial cobalamin production .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, please include it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
cobS; DR_A0239; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Target Names
cobS
Target Protein Sequence
MVQPSPAPVVTITPAPAPAAPSHPHGWKRKQEFKALHLALAFLTTLPLPHVRDVQPGDFA RASAYYPLAGYAVGGLVAGLLYLNVPLPPGVVAALGVGLWLGLTGMLHFDGLVDSADALF AMKSPEQRLDILKDVHVGAFGLATGVLALLLLWSLLGAGLPWYAPLVAAVVARMVVLMPM NAYPAARQESLGAQSRQGRWGLAFLFALPALLLPHAWLAALVALLGVTLVAAWAARRLGG GLSGDVYGLLIVVAELLVLGFYGWGFTPL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) is an enzyme that participates in the biosynthesis of cobalamin (vitamin B12). Specifically, it catalyzes the two-step reaction that joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of CobS in the cobalamin biosynthesis pathway of D. radiodurans?

Cobalamin synthase (CobS) in D. radiodurans functions in the final stages of cobalamin biosynthesis, catalyzing the attachment of the lower axial ligand to the corrin ring structure. This enzyme belongs to the "Group B" class of cobalamin biosynthesis proteins involved in final synthesis and repair processes. D. radiodurans, like other cobalamin-producing bacteria, employs CobS to facilitate the attachment of 5,6-dimethylbenzimidazole (DMB) to the corrin ring complex, which is critical for producing biologically active forms of vitamin B12 . The enzymatic activity of CobS represents a vital checkpoint in completing the functional coenzyme structure that serves as an essential cofactor for numerous metabolic processes.

How does the genomic context of cobS differ in D. radiodurans compared to other bacteria?

In D. radiodurans, the cobS gene exists within a genome characterized by unique repair mechanisms and extreme resistance to DNA-damaging conditions. Unlike conventional bacteria, D. radiodurans possesses specific genomic adaptations that allow cobS and other essential genes to maintain functionality even after severe genomic damage. The gene is part of the specialized final synthesis and repair operations (Group B genes) that contribute approximately 26.3% of the total soil microbial community's genetic capacity for cobalamin synthesis . The genomic positioning of cobS in D. radiodurans likely reflects evolutionary adaptations that enable this extremophile to maintain critical vitamin biosynthesis pathways even under severe stress conditions.

What structural features distinguish D. radiodurans CobS from homologous enzymes in other organisms?

The CobS enzyme from D. radiodurans exhibits structural adaptations consistent with the organism's extremophilic nature. As part of the broader classification of cobalamin biosynthesis proteins, D. radiodurans CobS contains functional domains conserved across cobalamin-producing taxa but may incorporate unique structural elements that confer stability under radiation and desiccation. Though specific structural data is limited, the enzyme likely shares core catalytic features with CobS proteins from related Actinobacteria while incorporating adaptations that enable functionality in the context of D. radiodurans' extreme resistance mechanisms . These adaptations may include enhanced protein stability, specialized substrate-binding regions, or modifications that protect the enzyme's active site under stress conditions.

How does radiation exposure affect CobS expression and activity in D. radiodurans?

Radiation exposure triggers complex transcriptional responses in D. radiodurans, including the regulation of cobalamin biosynthesis genes. Similar to the ssb gene, which shows induced expression after irradiation, cobS expression likely increases following radiation exposure as part of the organism's recovery mechanisms . The exceptional radiation resistance of D. radiodurans suggests that CobS maintains functional integrity under conditions that would otherwise compromise protein structure and function. Research indicates that genes involved in final synthesis and repair of cobalamin, including cobS, may be specially regulated to ensure continued vitamin B12 production during recovery from radiation damage, when metabolic cofactors are crucial for DNA repair and cellular regeneration processes .

What is the interplay between CobS function and the RecA-dependent DNA repair pathways in D. radiodurans?

The relationship between CobS functionality and RecA-dependent DNA repair represents a fascinating research question. In D. radiodurans, RecA plays a central role in the extended synthesis-dependent strand annealing (ESDSA) mechanism, which is essential for accurate genome reassembly after severe DNA damage . Cobalamin, as a critical cofactor for numerous enzymes, likely supports DNA repair processes indirectly by enabling essential metabolic functions during recovery phases. When recA is mutated, gross genome rearrangements occur, potentially affecting the integrity and expression of cobalamin biosynthesis genes including cobS . This relationship suggests a potential metabolic link between vitamin B12 production and the extraordinary DNA repair capabilities of D. radiodurans, where CobS functionality might be preserved or specially regulated to support cellular recovery following genomic trauma.

How do alternative end-joining mechanisms influence the stability of the cobS gene in recA mutants of D. radiodurans?

In recA mutants of D. radiodurans, genome stability is compromised, with evidence pointing to alternative end-joining mechanisms mediating DNA repair and genomic rearrangements. These mechanisms utilize short repeats (4-11 bp) rather than long insertion sequences to facilitate repairs . The stability of the cobS gene under these conditions presents an intriguing research question, especially considering that all sequenced recA isolates show large deletions in chromosome II that overlap in a 35 kb genomic region . Depending on the genomic location of cobS, its integrity could be compromised in recA mutants, potentially affecting cobalamin biosynthesis capacity. This phenomenon raises questions about whether cobS is located in regions susceptible to alternative end-joining-mediated rearrangements, and how such genetic instability might impact vitamin B12 production in D. radiodurans under stress conditions.

What are the optimal conditions for expressing recombinant D. radiodurans CobS in heterologous systems?

The expression of recombinant D. radiodurans CobS requires carefully optimized conditions to ensure functional enzyme production. Based on research with similar D. radiodurans proteins, the following expression parameters typically yield optimal results:

ParameterRecommended ConditionNotes
Expression HostE. coli BL21(DE3) or RosettaRosetta strain recommended for rare codon usage
Induction Temperature18-22°CLower temperatures reduce inclusion body formation
IPTG Concentration0.1-0.5 mMLower concentrations favor soluble protein
Induction Duration16-20 hoursExtended time compensates for lower temperature
Media Supplementation1% glucose, trace metalsSupports cofactor incorporation
Buffer pH7.5-8.0Maintains enzyme stability

Successful expression often requires fusion tags (His6 or MBP) to enhance solubility and facilitate purification. Additionally, coexpression with molecular chaperones (GroEL/GroES) can significantly improve folding efficiency of this challenging extremophile protein. Post-expression handling should include gentle cell lysis methods and purification under reducing conditions to preserve enzymatic activity .

What assay methods can accurately measure CobS activity in vitro?

Accurate measurement of D. radiodurans CobS activity requires specialized assay methods that account for the enzyme's specific catalytic function in the cobalamin biosynthesis pathway. The following approaches provide reliable activity measurements:

Assay MethodMeasurement PrincipleAdvantages
HPLC-MS AnalysisQuantification of cobalamin intermediates and productsHigh specificity and product identification
SpectrophotometricAbsorbance changes during reaction (350-550 nm)Real-time kinetic measurements
Radioisotope IncorporationTracking labeled precursors into productsHighly sensitive for slow reactions
Coupled Enzyme AssayDetection via partner enzyme activityAmplifies signal for better detection

For optimal results, reaction conditions should maintain reducing environments (2-5 mM DTT or β-mercaptoethanol) with appropriate metal cofactors (typically cobalt and zinc). Activity assays should include appropriate controls, including heat-inactivated enzyme and reactions lacking key substrates. Given the complex nature of the cobalamin synthesis pathway, product verification through multiple analytical methods is strongly recommended to confirm specific CobS activity versus potential side reactions .

How can recombinant D. radiodurans CobS be purified to maintain native conformation and activity?

Purification of recombinant D. radiodurans CobS requires specialized approaches to preserve the native conformation and enzymatic activity of this extremophile protein:

Purification StageRecommended ApproachCritical Considerations
Initial CaptureIMAC (Ni-NTA for His-tagged protein)Use 5-10 mM imidazole in binding buffer to reduce non-specific binding
Intermediate PurificationIon Exchange ChromatographyDEAE or Q-Sepharose at pH 7.5-8.0 for optimal separation
Polishing StepSize Exclusion ChromatographySuperdex 200 column for final purity and oligomeric state verification
Buffer Composition50 mM Tris-HCl pH 7.8, 150 mM NaCl, 5% glycerol, 1 mM DTTStabilizes protein structure and prevents aggregation
Storage Conditions-80°C with 20% glycerol or flash-frozen in liquid N₂Maintains activity for several months

All purification steps should be performed at 4°C to minimize protein degradation. Adding protease inhibitors (PMSF, EDTA-free cocktail) during initial extraction is essential. For enhanced stability, the addition of 0.1-0.5 mM of appropriate metal cofactors (typically cobalt ions) may be necessary. Confirmation of proper folding through circular dichroism spectroscopy is recommended before activity assessment .

How should researchers design experiments to study the impact of oxidative stress on CobS function in D. radiodurans?

Designing experiments to assess oxidative stress effects on CobS function requires careful consideration of D. radiodurans' unique stress resistance mechanisms. A comprehensive experimental design should include:

Experimental ComponentApproachRationale
Stress InductionGraduated H₂O₂ exposure (0.1-100 mM) and ionizing radiation (0.5-10 kGy)Provides range of oxidative damage conditions
TimelineMultiple time points (0, 1, 3, 6, 12, 24, 48 h post-stress)Captures dynamic responses through recovery
Gene Expression AnalysisRT-qPCR targeting cobS and related genesQuantifies transcriptional responses
Protein Level AssessmentWestern blot with CobS-specific antibodiesMeasures protein abundance changes
Enzyme ActivityIn vitro and in vivo cobalamin synthesis assaysDetermines functional impact on CobS
Genetic ApproachWild-type vs. catalase/SOD mutantsIsolates oxidative stress response components
ControlsParallel experiments with E. coli expressing recombinant CobSComparative sensitivity benchmark

This multi-layered approach allows researchers to differentiate between direct oxidative damage to the CobS protein versus regulatory changes in expression. Additionally, incorporating metabolomic analysis of cobalamin intermediates and final products would provide insights into pathway bottlenecks under oxidative stress conditions .

What considerations are important when designing gene knockout or mutation studies involving cobS in D. radiodurans?

Gene knockout or mutation studies involving cobS in D. radiodurans require specialized approaches due to the organism's unique genomic features and potential essentiality of cobalamin biosynthesis:

Design ConsiderationRecommended ApproachImportant Notes
Knockout StrategyAllelic replacement with antibiotic markerMultiple genome copies require complete segregation verification
Conditional SystemsTetracycline-inducible expression systemEssential if cobS proves to be indispensable
Growth MediaSupplement with exogenous cobalamin (1-10 μg/ml)May rescue lethal phenotypes if pathway is essential
Genomic ContextConsider operon structure and polar effectsNeighboring gene expression may be affected
ComplementationTrans-complementation with native promoterCritical for confirming phenotype specificity
Mutation DesignTarget conserved catalytic residuesMore informative than full knockout for mechanistic studies
PhenotypingGrowth curves, radiation resistance, metabolomicsComprehensive assessment beyond simple viability

Researchers should be particularly attentive to D. radiodurans' efficient DNA repair mechanisms, which may counteract standard gene replacement approaches. When designing site-directed mutations, bioinformatic analysis to identify conserved catalytic residues should precede experimental work. Given the radiation-resistant nature of D. radiodurans, verification of genetic modifications should employ both PCR and whole-genome sequencing to confirm the absence of unintended mutations or adaptations .

What statistical approaches are most appropriate for interpreting CobS activity data under varying experimental conditions?

Analysis of CobS activity data requires robust statistical approaches that account for the complex factors influencing enzyme performance in extremophile systems:

Statistical ApproachApplicationAdvantage for CobS Research
Mixed-effects ModelingAnalyzing nested data structures with multiple variablesAccounts for batch effects and experimental replicates
Non-parametric MethodsComparing activity across divergent conditionsRobust to non-normal distributions common in enzyme kinetics
Bayesian AnalysisIntegrating prior knowledge with experimental dataParticularly valuable for limited sample sizes
Principal Component AnalysisIdentifying patterns across multiple experimental parametersReveals underlying factors driving activity variations
Response Surface MethodologyOptimizing multiple reaction conditions simultaneouslyEfficient for determining optimal CobS reaction conditions
Time Series AnalysisEvaluating dynamic changes in activityEssential for radiation recovery studies

Data normalization is particularly critical when comparing across different protein preparations or expression systems. Researchers should consider normalization to protein concentration, specific activity of reference enzymes, or internal standards. For kinetic studies, both Michaelis-Menten and allosteric models should be evaluated, as many biosynthetic enzymes exhibit complex regulation. Statistical significance should be assessed with appropriate corrections for multiple comparisons (e.g., Bonferroni or Benjamini-Hochberg procedures) .

How should researchers interpret contradictory findings about CobS function across different experimental systems?

Resolving contradictory findings about D. radiodurans CobS function requires systematic evaluation of potential experimental variables:

Source of VariationEvaluation ApproachResolution Strategy
Expression System DifferencesDirect comparison of protein properties from different hostsStandardize expression using consistent systems
Post-translational ModificationsMass spectrometry analysis of protein from native vs. recombinant sourcesExpress in hosts capable of appropriate modifications
Buffer/Reagent IncompatibilitiesSystematic testing of activity across buffer conditionsIdentify optimal conditions that reconcile differences
Assay Method LimitationsParallel analysis using multiple activity detection methodsDevelop consensus assay protocols
Natural Protein VariantsSequence verification and comparison to reference genomeAccount for strain-specific variations in interpretation
Experimental Stress ConditionsPrecisely control and monitor oxidation, temperature, pHStandardize environmental parameters across experiments

When faced with contradictory data, researchers should develop a hierarchical model that incorporates findings from multiple experimental systems, giving appropriate weight to results based on methodological robustness. The D. radiodurans biology presents unique challenges, as its extreme stress resistance mechanisms may influence enzyme behavior differently than in conventional model systems. Collaboration between laboratories using different approaches is particularly valuable for establishing consensus on CobS function and regulation .

What bioinformatic approaches can provide insights into CobS evolution and functional conservation across extremophiles?

Bioinformatic analysis of CobS across extremophiles can reveal evolutionary adaptations and functional conservation patterns:

Bioinformatic MethodApplication to CobS ResearchExpected Insights
Phylogenetic AnalysisConstruction of CobS evolutionary trees across bacterial phylaEvolutionary history and horizontal gene transfer events
Protein Domain ArchitectureIdentification of conserved motifs and variable regionsFunctional domains vs. adaptative regions
Molecular Dynamics SimulationModeling protein behavior under extreme conditionsStructural adaptations to radiation/desiccation
Coevolution AnalysisIdentification of coordinated mutations across protein networksFunctional interactions with other cobalamin synthesis proteins
Structural Homology ModelingPrediction of 3D structure based on solved homologsActive site configuration and substrate binding
Genomic Context AnalysisExamination of neighboring genes across speciesOperon structure and regulatory elements
Positive Selection AnalysisIdentification of amino acid positions under adaptive pressureKey residues for extremophile adaptation

Data visualization is critical for interpreting these analyses, with tools like PyMOL for structural visualization and Jalview for sequence alignment display. When comparing across extremophiles, researchers should consider phylogenetic distance alongside environmental adaptations to distinguish convergent evolution from shared ancestry. The resulting insights can guide targeted mutagenesis experiments to validate the functional significance of identified regions and potentially engineer enhanced enzyme variants for biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.