Recombinant Deinococcus radiodurans Glycerol-3-phosphate acyltransferase 2 (plsY2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
plsY2; DR_2270; Glycerol-3-phosphate acyltransferase 2; Acyl-PO4 G3P acyltransferase 2; Acyl-phosphate--glycerol-3-phosphate acyltransferase 2; G3P acyltransferase 2; GPAT 2; Lysophosphatidic acid synthase 2; LPA synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-195
Protein Length
full length protein
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Target Names
plsY2
Target Protein Sequence
MRAVVSLAVVFVLSYLLGSLVAGVLYSRGRGEDIRGRDLPGGSGTYRQYGKGAAAAVTLA DILKGAAAVGLALWLAPQALPLATALATFGVVFGHCYPVWFGFRGGGGIAPFLGAMLVVA PWTLLATVTFALALIPLYRATLQPRLRLNAIPFATVVAVPVGLLIASRLGGGAEFLAGSA AMGIRAVHLLAEQRA
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), yielding lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links

KEGG: dra:DR_2270

STRING: 243230.DR_2270

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does plsY2 function in the context of D. radiodurans' unique lipid metabolism?

The plsY2 protein functions as an acyltransferase that catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid (LPA). This is a critical step in phospholipid biosynthesis. In D. radiodurans, this process is particularly interesting because the organism contains unique lipid structures, including glucosyl diglyceride lipids that may contribute to its extraordinary stress resistance .

D. radiodurans contains diverse carbohydrate-containing lipids, including those with glucose, galactose, and N-acetylglucosamine components . The plsY2 enzyme's activity likely contributes to the initial synthesis of the phospholipid backbone upon which these complex structures are built, potentially playing an indirect role in the organism's resistance mechanisms by maintaining membrane integrity under extreme conditions.

What is known about the evolutionary conservation of plsY2 across bacterial species?

While plsY2 is found in D. radiodurans, comparative genomic analyses reveal that acyltransferases of this family are widely distributed across bacterial species. Unlike some other proteins unique to Deinococcus, the lipid biosynthesis pathways involving plsY2 have counterparts in both gram-negative and gram-positive bacteria .

What are the optimal conditions for expressing recombinant D. radiodurans plsY2 in E. coli systems?

For optimal expression of recombinant D. radiodurans plsY2 in E. coli, the following methodology is recommended:

  • Vector Selection: Use vectors with strong inducible promoters (T7 or tac) and N-terminal His-tags for easier purification

  • Host Strain: BL21(DE3) or Rosetta strains are preferred due to their reduced protease activity

  • Growth Conditions:

    • Initial growth at 37°C to OD₆₀₀ of 0.6-0.8

    • Temperature reduction to 18-20°C before induction

    • Induction with 0.1-0.5 mM IPTG

    • Post-induction expression for 16-18 hours

As plsY2 is a membrane-associated protein, it may form inclusion bodies if overexpressed. Addition of 0.5-1% glucose to the growth medium and lower induction temperatures can help maintain protein solubility . Additionally, considering the membrane association of this protein, supplementation with specific phospholipids or detergents during expression may improve functional yield.

What purification strategy yields the highest purity and activity of recombinant plsY2?

A multi-step purification strategy is recommended for obtaining high-purity, active recombinant plsY2:

  • Cell Lysis: Use a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and appropriate detergent (0.5-1% n-dodecyl β-D-maltoside) to solubilize membrane-associated plsY2

  • Initial Purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with imidazole gradient elution (50-250 mM)

  • Secondary Purification: Size exclusion chromatography using a Superdex 200 column to remove aggregates and contaminants

  • Final Preparation: Concentration to 0.1-1.0 mg/mL in Tris/PBS-based buffer (pH 8.0) with 6% trehalose as a stabilizer

The purified protein should be stored with glycerol (final concentration 30-50%) and stored at -80°C in small aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce activity . For long-term storage, lyophilization in the presence of trehalose has been shown to maintain protein stability.

How can researchers assess the functional activity of purified recombinant plsY2?

The functional activity of purified recombinant plsY2 can be assessed through several complementary approaches:

  • Acyltransferase Activity Assay:

    • Substrate: Glycerol-3-phosphate and acyl-phosphate

    • Detection: Formation of lysophosphatidic acid (LPA) by:

      • Radioactive assay using ¹⁴C-labeled substrates

      • HPLC analysis of reaction products

      • Coupled enzyme assay measuring released phosphate

  • Membrane Binding Assay:

    • Liposome flotation assay using synthetic liposomes

    • Analysis of protein partitioning between aqueous and membrane-mimetic environments

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to confirm proper folding

The activity of plsY2 is highly dependent on maintaining its native membrane environment or suitable detergent micelles during purification and storage. For accurate activity measurements, assay conditions should mimic the physiological environment, including pH (~6.5-7.5), temperature (30-37°C), and ionic strength .

How can plsY2 be utilized as a model system for studying membrane protein function in extremophiles?

The plsY2 protein offers an excellent model system for studying membrane protein adaptations in extremophiles due to several unique characteristics:

  • Membrane Association: As an integral membrane protein involved in lipid biosynthesis, plsY2 directly interacts with the membrane environment that contributes to D. radiodurans' extreme resistance properties

  • Experimental Approaches:

    • Reconstitution in nanodiscs or liposomes with varying lipid compositions

    • Site-directed mutagenesis of putative membrane-interacting residues

    • Comparative structural studies with homologs from non-extremophilic bacteria

  • Research Applications:

    • Investigation of protein stability under extreme conditions (radiation, desiccation)

    • Analysis of protein-lipid interactions that may contribute to membrane rigidity

    • Exploration of enzyme kinetics in various membrane environments

By comparing the structure-function relationships of plsY2 from D. radiodurans with homologous proteins from non-extremophilic bacteria, researchers can identify specific adaptations that enable membrane protein function under extreme conditions. This comparative approach can reveal how changes in amino acid composition, protein folding, and lipid interactions contribute to protein stability in harsh environments .

What role might plsY2 play in the radiation resistance mechanisms of D. radiodurans?

While plsY2 is not directly involved in DNA repair mechanisms, it may contribute to D. radiodurans' radiation resistance through several indirect pathways:

  • Membrane Integrity Maintenance:

    • Synthesis of lipid precursors for specialized membrane structures

    • Production of lipids that protect against oxidative damage

    • Contribution to membrane properties that compartmentalize repair enzymes

  • Connection to Antioxidant Systems:

    • Potential role in forming lipid environments for manganese antioxidant complexes

    • Synthesis of phospholipids that may interact with Mn²⁺ complexes critical for protein protection

  • Stress Response Integration:

    • Possible adaptation of enzymatic activity under stress conditions

    • Potential involvement in stress-triggered membrane remodeling

How can researchers effectively use site-directed mutagenesis to study plsY2 structure-function relationships?

Site-directed mutagenesis offers a powerful approach for dissecting plsY2 structure-function relationships:

Mutation TargetRationaleExpected OutcomeAnalysis Method
Catalytic residues (H, D, S)Identify active site componentsReduced or abolished enzymatic activityAcyltransferase activity assay
Membrane-binding regionsUnderstand membrane associationAltered subcellular localizationMembrane fractionation, fluorescence microscopy
Substrate-binding pocketDefine substrate specificityChanged preference for acyl chain lengthKinetic analysis with various substrates
Conserved motifsTest evolutionary importanceVariable effects depending on conservation levelComparative activity with homologs

Methodological Approach:

  • Mutation Design:

    • Use multiple sequence alignments with homologs to identify conserved residues

    • Apply computational structure prediction tools to identify putative functional domains

    • Create both conservative and non-conservative mutations

  • Expression and Analysis:

    • Express wild-type and mutant proteins under identical conditions

    • Compare biochemical properties, including thermal stability and pH optimum

    • Assess membrane association using fractionation techniques

  • Functional Complementation:

    • Test mutants' ability to rescue plsY knockout phenotypes in model organisms

    • Analyze growth under various stress conditions to link structural features to stress resistance

This systematic mutagenesis approach enables researchers to connect specific amino acid residues or structural elements with functional roles, providing insights into how plsY2 contributes to the unique lipid composition of D. radiodurans membranes .

How does plsY2 interact with the unique lipid environment of D. radiodurans and contribute to its stress resistance mechanisms?

The interaction between plsY2 and D. radiodurans' unique lipid environment represents a complex relationship that likely contributes to the organism's remarkable stress resistance:

  • Specialized Lipid Synthesis:
    D. radiodurans possesses unusual lipid structures, including 1,2-diacyl-3-alpha-glucopyranosyl-glycerol and 3-O-[6'-O-(1",2"-diacyl-3"-phosphoglycerol)-alpha-glucopyranosyl]-1,2-diacylglycerol . The plsY2 enzyme contributes to the initial steps of generating the diacylglycerol backbones that serve as precursors for these complex lipids.

  • Membrane-Protein-Lipid Interactions:
    The hydrophobic domains of plsY2 likely interact with these specialized lipids in ways that maintain enzyme activity under extreme conditions. These interactions may be critical for preserving membrane fluidity and preventing membrane damage during desiccation or radiation exposure .

  • Integration with Antioxidant Systems:
    D. radiodurans' radiation resistance depends significantly on manganese antioxidant complexes that protect proteins from oxidative damage . The lipid environment created in part through plsY2 activity may facilitate the formation and maintenance of these protective complexes within the membrane.

Advanced research techniques including neutron reflectometry, solid-state NMR, and molecular dynamics simulations can help elucidate the specific interactions between plsY2 and D. radiodurans' unique membrane environment, providing insights into how these interactions contribute to extreme stress resistance .

What insights can comparative studies of plsY2 across Deinococcus species provide about evolution of extremophilic traits?

Comparative studies of plsY2 across Deinococcus species and related bacteria can reveal important evolutionary insights:

  • Sequence-Function Relationships:

    • Analysis of sequence conservation in catalytic domains versus membrane-interacting regions

    • Identification of Deinococcus-specific adaptations versus core enzymatic features

    • Correlation between amino acid substitutions and extremophilic capabilities

  • Gene Context and Regulation:

    • Examination of gene neighborhood conservation/divergence

    • Analysis of regulatory elements controlling plsY2 expression under stress

    • Identification of potential co-evolved gene partners in lipid metabolism

  • Structural Biology Approaches:

    • Comparative structural modeling of plsY2 variants

    • Investigation of protein dynamics under extreme conditions

    • Correlation of structural features with environmental adaptations

While radiation resistance in Deinococcus species relies heavily on DNA repair mechanisms and protein protection through manganese complexes , comparative genomic studies have shown that these traits evolved through complex pathways rather than simple acquisition of specific genes . Similarly, the evolution of plsY2 likely reflects selective pressures on membrane systems to maintain integrity under extreme conditions, with specific adaptations potentially correlating with the degree of extremophily across species.

How can synthetic biology approaches utilizing plsY2 be employed to engineer radiation-resistant membranes?

Synthetic biology approaches using plsY2 offer promising strategies for engineering radiation-resistant membranes:

  • Heterologous Expression Systems:

    • Integration of D. radiodurans plsY2 into non-resistant bacteria

    • Co-expression with complementary enzymes from D. radiodurans lipid biosynthesis pathways

    • Creation of synthetic operons combining plsY2 with genes for unique lipid modifications

  • Engineered Membrane Compositions:

    • Manipulation of lipid profiles through targeted expression of plsY2 variants

    • Creation of hybrid membranes incorporating D. radiodurans-specific lipids

    • Design of synthetic lipids that enhance radiation resistance when incorporated via plsY2 activity

  • Applications and Experimental Design:

    • Development of radiation-resistant bioremediation platforms

    • Creation of robust biosensors for extreme environments

    • Engineering of stress-resistant chassis organisms for synthetic biology

The experimental approach would involve:

  • Initial characterization of native plsY2 kinetic parameters

  • Engineering of expression systems with controlled activity levels

  • Analysis of resulting membrane compositions

  • Testing engineered strains under increasing radiation doses

While direct transfer of radiation resistance is challenging due to its multigenic nature , engineering membranes through plsY2 and related enzymes could enhance protection against oxidative damage, potentially providing increased resistance to radiation and other stressors. This approach aligns with research indicating that protein and membrane protection, rather than DNA repair alone, are critical for extreme radiation resistance .

What are the optimal analytical techniques for studying the enzymatic activity of plsY2 in different membrane environments?

The study of plsY2 enzymatic activity in various membrane environments requires specialized analytical techniques:

TechniqueApplicationAdvantagesLimitations
Liposome-based activity assaysMeasuring activity in defined lipid environmentsControllable membrane compositionArtificial system may not reflect native interactions
Native membrane vesicle incorporationActivity in near-native environmentMore physiologically relevantDifficult to control exact composition
Surface plasmon resonance (SPR)Real-time binding kineticsLabel-free detectionRequires immobilization that may affect activity
Radiolabeled substrate incorporationDirect measurement of product formationHigh sensitivityRadiation safety concerns, specialized facilities needed
LC-MS/MS analysis of lipid productsDetailed characterization of reaction productsComprehensive analysis of complex productsExpensive equipment, complex data analysis

Methodological Recommendations:

  • Membrane Reconstitution Protocol:

    • Purify plsY2 in mild detergents (0.05% DDM or LMNG)

    • Prepare liposomes with varying lipid compositions

    • Remove detergent gradually using Bio-Beads or dialysis

    • Verify incorporation using sucrose gradient ultracentrifugation

  • Activity Measurement:

    • Prepare reaction mixtures containing reconstituted plsY2, glycerol-3-phosphate, and acyl-phosphate donors

    • Incubate at 30°C (optimal temperature for D. radiodurans enzymes)

    • Extract lipids using Bligh-Dyer method

    • Analyze products using thin-layer chromatography or LC-MS

  • Environmental Variable Testing:

    • Examine effects of temperature (4-60°C), pH (5-9), and ionic strength

    • Test activity before and after radiation exposure

    • Assess impact of membrane fluidizers or rigidifiers

    • Compare activity in the presence of various divalent cations, particularly Mn²⁺

These approaches enable detailed characterization of how membrane environment influences plsY2 activity, providing insights into its role in D. radiodurans' adaptation to extreme conditions .

What strategies can resolve contradictory data on plsY2 structure predictions from different computational approaches?

Resolving contradictory structural predictions for plsY2 requires an integrated approach:

  • Critical Assessment of Computational Methods:

    • Compare results from multiple prediction algorithms (AlphaFold, SWISS-MODEL, Rosetta)

    • Evaluate reliability scores for each prediction

    • Identify consensus regions versus divergent predictions

    • Consider algorithm biases (some perform better for membrane proteins than others)

  • Experimental Validation Approaches:

    • Circular dichroism spectroscopy to confirm secondary structure elements

    • Limited proteolysis coupled with mass spectrometry to identify exposed regions

    • Crosslinking studies to validate predicted proximity relationships

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

  • Reconciliation Strategy:

    • Develop a consensus model prioritizing regions with high prediction confidence

    • Generate multiple working hypotheses for divergent regions

    • Design experiments specifically targeting ambiguous structural elements

    • Validate functional predictions through site-directed mutagenesis

  • Iterative Refinement Protocol:

    • Begin with experimental testing of the most divergent predictions

    • Update computational models with experimental constraints

    • Gradually build a hybrid model incorporating both computational predictions and experimental data

This systematic approach acknowledges the challenges of membrane protein structure prediction while leveraging the strengths of both computational and experimental methods. The highly hydrophobic nature of plsY2 with multiple transmembrane regions makes it particularly challenging for standard structure prediction algorithms, necessitating this integrated strategy.

How can researchers design experiments to elucidate the potential interplay between plsY2 and the manganese antioxidant systems in D. radiodurans?

Investigating the interplay between plsY2 and manganese antioxidant systems requires carefully designed experiments:

  • Colocalization and Interaction Studies:

    • Fluorescence microscopy with differentially labeled plsY2 and manganese transporters

    • Proximity ligation assays to detect protein-protein interactions

    • Co-immunoprecipitation followed by mass spectrometry

    • Membrane fractionation to identify shared microdomains

  • Functional Relationship Assessment:

    • Gene knockout and complementation studies examining:

      • Manganese accumulation in plsY2 mutants

      • Lipid profiles in manganese transport mutants

      • Radiation sensitivity of various mutant combinations

    • Transcriptional analysis to identify co-regulated pathways

  • Membrane Environment Characterization:

    • Analysis of lipid composition around manganese transport complexes

    • EPR spectroscopy to examine Mn²⁺ coordination in different membrane environments

    • Measurement of reactive oxygen species scavenging in membranes with altered lipid composition

  • Integrated Systems Biology Approach:

    • Correlation analysis between lipid profiles, manganese content, and radiation resistance

    • Network analysis of protein-protein interactions linking membrane and antioxidant systems

    • Metabolic flux analysis to track connections between lipid metabolism and antioxidant production

This experimental strategy addresses the hypothesis that plsY2 may contribute indirectly to D. radiodurans' radiation resistance by creating membrane environments that support the formation and activity of manganese antioxidant complexes . The evidence that protein protection via manganese complexes, rather than DNA repair alone, is critical for extreme radiation resistance makes this potential interplay particularly significant for understanding D. radiodurans' unique capabilities.

What are the most common technical challenges in working with recombinant plsY2 and how can they be addressed?

Researchers working with recombinant plsY2 commonly encounter several technical challenges:

  • Low Expression Yield:

    • Problem: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for expression host, use specialized strains (C41/C43), lower induction temperature (16-18°C), and test multiple fusion tags (MBP, SUMO) to enhance solubility

  • Protein Aggregation:

    • Problem: Hydrophobic regions tend to aggregate during purification

    • Solution: Use mild detergents (DDM, LMNG), include glycerol (10-15%) in all buffers, optimize salt concentration (300-500 mM), and consider adding stabilizing agents like trehalose

  • Loss of Activity During Purification:

    • Problem: Enzyme activity diminishes with each purification step

    • Solution: Minimize purification steps, maintain consistent temperature, include protecting agents (DTT, glycerol), and consider adding D. radiodurans lipid extracts to maintain native-like environment

  • Inconsistent Activity Assays:

    • Problem: Variable results in enzyme activity measurements

    • Solution: Standardize substrate preparation (especially acyl-phosphate donors which are unstable), control detergent concentrations precisely, and develop internal controls for each assay batch

Recommended Optimization Protocol:

  • Expression Screening:

    • Test multiple expression vectors (pET, pBAD, pMAL)

    • Evaluate different E. coli strains (BL21, C41/C43, Rosetta)

    • Try various induction conditions (temperature, inducer concentration, duration)

  • Purification Optimization:

    • Screen detergent panel (maltoside series, neopentyl glycol series)

    • Test purification in presence of D. radiodurans lipid extracts

    • Optimize buffer components (pH 7.0-8.5, NaCl 150-500 mM)

    • Include stabilizers like 6% trehalose in final preparations

This systematic approach addresses the inherent challenges of working with membrane-associated acyltransferases and maximizes the likelihood of obtaining functional protein for downstream applications .

How can researchers optimize heterologous expression systems for functional studies of plsY2?

Optimizing heterologous expression of plsY2 for functional studies requires a multi-faceted approach:

  • Expression Vector Design:

    • Promoter Selection: Use tunable promoters (trc, tac, araBAD) rather than strong constitutive promoters to prevent toxicity

    • Fusion Partner Strategy: Test N-terminal fusions (MBP, SUMO, Trx) that enhance solubility while remaining cleavable

    • Affinity Tag Placement: Compare N-terminal versus C-terminal tags to determine minimal impact on function

    • Codon Optimization: Adjust rare codons while maintaining critical translational pausing sites

  • Host Strain Engineering:

    • Membrane Protein Specialists: Use C41/C43 (DE3) strains derived for membrane protein expression

    • Chaperone Co-expression: Include plasmids encoding GroEL/GroES, DnaK/DnaJ/GrpE systems

    • Media Supplementation: Add phospholipid precursors (glycerol-3-phosphate, fatty acids) to growth media

    • Growth Phase Control: Induce at higher cell densities (OD₆₀₀ = 0.8-1.0) for membrane proteins

  • Expression Condition Matrix:

    ParameterRange to TestMonitoring Method
    Temperature16°C, 25°C, 30°CSDS-PAGE and Western blot
    Inducer concentration0.01-0.5 mM IPTG or 0.001-0.2% arabinoseActivity assay and membrane fraction yield
    Expression duration4h, 8h, 16h, 24hTime-course Western blot
    Media compositionLB, TB, autoinduction mediaBiomass and protein yield per liter
  • Functional Verification Tests:

    • In vivo complementation of E. coli plsY mutants

    • Membrane localization confirmation via fractionation

    • Activity assays with native versus artificial substrates

    • Thermal shift assays to verify proper folding

This comprehensive optimization strategy addresses the challenges specific to membrane-associated acyltransferases like plsY2, enabling researchers to obtain sufficient quantities of properly folded, active enzyme for detailed functional studies .

What are the critical factors to consider when designing experiments to investigate plsY2's role in membrane stress responses?

When investigating plsY2's role in membrane stress responses, researchers should consider these critical experimental design factors:

  • Stress Exposure Protocols:

    • Radiation Stress: Use incremental doses (0.1-15 kGy) of gamma radiation with controlled dose rates

    • Desiccation Stress: Implement standardized drying protocols with defined relative humidity and rehydration conditions

    • Oxidative Stress: Apply H₂O₂ (0.1-50 mM) or paraquat treatments with time-course sampling

    • Temperature Stress: Test responses across D. radiodurans' growth range (4-45°C) with controlled ramping rates

  • Genetic Manipulation Strategies:

    • Create conditional knockdowns rather than complete knockouts if plsY2 is essential

    • Design complementation strains with wild-type and mutant versions under native promoters

    • Consider generating chimeric proteins with domains from non-extremophilic organisms

    • Create reporter fusions to monitor expression changes under stress conditions

  • Membrane Analysis Techniques:

    • Composition Assessment: Lipidomics analysis before, during, and after stress exposure

    • Fluidity Measurements: Fluorescence anisotropy with DPH or laurdan probes

    • Permeability Testing: Fluorescent dye leakage assays under different stress conditions

    • Structural Imaging: Cryo-electron microscopy of membrane ultrastructure changes

  • Control Considerations:

    • Include non-extremophilic bacteria expressing D. radiodurans plsY2

    • Compare responses in wild-type versus plsY2-modified strains

    • Assess other lipid biosynthesis enzymes to identify pathway-specific versus plsY2-specific effects

    • Measure both acute (immediate) and adaptive (recovery) responses

The experimental design should acknowledge that D. radiodurans' stress resistance is multifactorial, involving DNA repair systems, protein protection via manganese complexes, and potentially specialized membrane structures . By isolating variables and using appropriate controls, researchers can determine the specific contribution of plsY2 to membrane-mediated stress responses in this extraordinary organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.