Recombinant Deinococcus radiodurans Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Catalytic Role:

  • Cleaves the N-terminal signal peptide of prolipoproteins after the conserved lipobox motif, enabling mature lipoprotein integration into membranes .

  • Functions as part of the lipoprotein-processing pathway, a target for antibiotic development due to its essential role in Gram-negative bacteria .

Enzyme Classification:

PropertyDetail
EC Number3.4.23.36
Uniprot IDQ9RRU7
Gene NamelspA (DR_2388 locus in D. radiodurans strain ATCC 13939)
Molecular FunctionAspartyl protease; membrane-bound signal peptidase

Research Implications

Antibiotic Development:

  • LspA’s conserved active site and essentiality make it a high-priority target for novel antibiotics . Resistance mutations are rare due to functional constraints on substrate binding .

Biotechnological Applications:

  • Used in studies probing bacterial membrane protein assembly and lipoprotein trafficking mechanisms .

  • Structural models aid in rational drug design against multidrug-resistant pathogens .

Limitations and Future Directions

  • Structural Gaps: No apo or substrate-bound crystal structures for D. radiodurans LspA exist; current models derive from Pseudomonas and Staphylococcus homologs .

  • Functional Studies: Further research is needed to characterize substrate specificity and regulatory mechanisms in Deinococcus .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
lspA; DR_2388; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Target Names
lspA
Target Protein Sequence
MWPFSRQQNVSRILPIVPTAPRRFPVWFPAVLVLVLIALDQWLKAWALAHLQLNAPAIPV IPGVLDWELTFNTGAAWSMFSGSAVPLALGRILVGLGILSYLLWKPQGRFLTVVLSMIAA GAIGNSIDGLQRGQVTDMIHSPLLSAVTEAINGTRFPIFNIADMCVVGGTILLLVASLLP ERKREKAVPEA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: dra:DR_2388

STRING: 243230.DR_2388

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Lipoprotein signal peptidase (LspA) and what role does it play in bacterial physiology?

    Lipoprotein signal peptidase (LspA) is an aspartyl protease that plays a crucial role in the lipoprotein processing pathway of bacteria. It specifically cleaves the transmembrane helix signal peptide of lipoproteins after they have been lipidated. LspA is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria, making it an excellent target for antibiotic development with potentially low resistance development . In D. radiodurans, as in other bacteria, LspA likely contributes to membrane integrity and protein localization, which may be particularly important given D. radiodurans' exceptional resistance to environmental stressors.

  • How does the structure of LspA facilitate its function in the bacterial membrane?

    LspA is a membrane-embedded enzyme with several key structural features that enable its function:

    • A catalytic dyad composed of conserved aspartate residues

    • A periplasmic helix (PH) that undergoes conformational dynamics

    • A β-cradle structure that helps position the substrate

    The enzyme demonstrates significant conformational flexibility, particularly in the periplasmic helix, which fluctuates on the nanosecond timescale. In the apo (unbound) state, the dominant conformation is closed, occluding the charged active site from the lipid bilayer. This flexibility explains how LspA can accommodate and process a variety of substrate lipoproteins .

  • What expression systems are typically used for recombinant D. radiodurans LspA production?

    Based on protocols used for other bacterial LspA proteins, recombinant D. radiodurans LspA is typically expressed using:

    • E. coli expression systems with pET vector series (e.g., pET28b)

    • N-terminal tags such as 6xHis for purification

    • Thrombin cleavage sequences for tag removal

    For example, P. aeruginosa LspA has been successfully expressed using an N-terminal 6xHis tag in a pET28b vector, which could serve as a model for D. radiodurans LspA expression .

Methodological Research Questions

  • What purification protocol would be optimal for recombinant D. radiodurans LspA?

    A recommended purification protocol based on successful approaches with other bacterial LspA proteins would include:

    1. Expression in E. coli with an N-terminal 6xHis tag

    2. Cell lysis via sonication or French press in buffer containing detergent

    3. Solubilization of membrane fraction using appropriate detergents (e.g., FC12)

    4. Nickel affinity chromatography for initial purification

    5. Optional tag removal using thrombin

    6. Size exclusion chromatography for final purification

    Crucial considerations include maintaining proper detergent concentration throughout purification and avoiding protein aggregation .

  • How can continuous-wave (CW) and pulsed EPR be optimized for studying D. radiodurans LspA conformational dynamics?

    For effective EPR studies of D. radiodurans LspA:

    CW EPR Protocol:

    • Use single cysteine mutants labeled with spin labels

    • Utilize FC12 detergent micelles for protein stabilization

    • Sample volume of approximately 7 μL in 0.6-mm glass capillaries

    • Perform measurements at room temperature

    • Avoid DMSO in sample preparation as it impacts spectra

    Pulsed EPR (DEER) Protocol:

    • Prepare double-labeled LspA in FC12 detergent micelles

    • Use approximately 300 μM protein concentration with 20% deuterated glycerol

    • Load 15 μL samples into quartz capillaries

    • Perform measurements at Q-band and 80 K

    • Use a four-pulse DEER sequence with 16-step phase cycling

    • For antibiotic binding studies, use a 20:1 molar ratio of antibiotic to protein

    Data processing would use appropriate software like DEERAnalysis2018 with Tikhonov regularization .

  • What site-directed mutagenesis strategies are most informative for studying D. radiodurans LspA function?

    The most informative mutagenesis approach would target:

    • Catalytic dyad residues (conserved aspartates) to confirm enzymatic mechanism

    • Periplasmic helix residues to study conformational dynamics

    • β-cradle residues that might interact with substrate

    • Membrane-interfacing residues that could affect stability

    When selecting sites for spin labeling:

    • Avoid highly conserved residues and those with evolutionary coupling

    • Select sites on β-strands rather than loops for reduced backbone dynamics

    • Choose sites that are not at tertiary contacts

    • For distance measurements between domains, select residue pairs within optimal DEER detection range

    Appropriate methods include PIPE Mutagenesis or QuikChange protocols, with sequence confirmation by DNA sequencing .

  • How can molecular dynamics simulations be optimized for studying D. radiodurans LspA?

    For effective MD simulations of D. radiodurans LspA:

    • Use an all-atom approach with explicit membrane and solvent

    • Run multiple independent trajectories to ensure sampling of conformational space

    • Simulate both apo and antibiotic-bound states for comparison

    • Analyze periplasmic helix fluctuations and β-cradle interactions

    • Compare simulation results with experimental EPR data for validation

    A hybrid approach combining MD simulations with experimental restraints from EPR would provide the most reliable structural models. This approach has successfully revealed conformational dynamics in LspA from other bacteria that were not apparent from static crystal structures .

  • What methods are most effective for assessing the inhibition of D. radiodurans LspA activity?

    To effectively assess inhibition of D. radiodurans LspA:

    • Develop an in vitro assay using purified recombinant LspA and synthetic peptide substrates

    • Assess cleavage products using techniques such as HPLC or mass spectrometry

    • For antibiotic binding studies, test different ratios of inhibitor to enzyme

    • Include controls to distinguish between competitive and non-competitive inhibition

    • Correlate functional inhibition with structural changes using EPR or other biophysical methods

    For example, when studying globomycin binding to LspA, specific preparation protocols are needed: resuspending globomycin in DMSO at 10 mg/mL, aliquoting and drying in a lyophilizer, then resuspending with the protein sample to avoid DMSO interference with spectroscopic measurements .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.