Recombinant Deinococcus radiodurans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery information, please consult your local distributors.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
nuoK; DR_1495; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Target Names
nuoK
Target Protein Sequence
MPEMVPTSYYLALSGVLFALGLIGVMTRRTAILIFLSVELMLNAANIALVAFARSWGDLM GQTAVFIVMTLAAAEVAIGLAIIVAIFRGRETTNVDDLAQLRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's primary electron acceptor is believed to be menaquinone. It couples the redox reaction with proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thereby conserving redox energy in a proton gradient.
Database Links

KEGG: dra:DR_1495

STRING: 243230.DR_1495

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Deinococcus radiodurans NADH-quinone oxidoreductase subunit K (nuoK)?

NADH-quinone oxidoreductase subunit K (nuoK) in Deinococcus radiodurans is a component of the Type I NADH dehydrogenase complex, encoded by the gene DR_1495. The full-length protein consists of 103 amino acids and functions as a membrane-bound subunit involved in the respiratory electron transport chain . Unlike Type II NADH:quinone oxidoreductases (NDH-2), which are single-subunit proteins with just a flavin cofactor, nuoK is part of the multi-subunit NDH-1 complex that contributes to energy metabolism in this extremophilic bacterium .

The primary function of this protein involves the transfer of electrons from NADH to quinones in the electron transport chain, playing a critical role in cellular respiration. This process is particularly significant in D. radiodurans, which must maintain robust energy metabolism even under extreme stress conditions that would be lethal to most other organisms .

How should recombinant D. radiodurans nuoK be stored and handled for optimal stability?

For optimal stability of recombinant D. radiodurans nuoK, researchers should follow these methodological guidelines:

  • Storage conditions: Store the lyophilized protein at -20°C to -80°C upon receipt. After reconstitution, store working aliquots at 4°C for up to one week .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended) and aliquot for long-term storage at -20°C/-80°C

  • Handling considerations:

    • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

    • Work with the protein in appropriate buffer conditions (Tris/PBS-based buffer, pH 8.0 with 6% Trehalose is used for storage)

    • When designing experiments, consider the hydrophobic nature of this membrane protein

These storage and handling procedures are critical for maintaining the structural integrity and biological activity of the recombinant protein during experimental work.

What expression systems are recommended for producing recombinant D. radiodurans nuoK?

For successful expression of recombinant D. radiodurans nuoK, Escherichia coli is the recommended heterologous expression system, particularly for research purposes . When selecting an expression system, researchers should consider:

  • Strain selection: BL21(DE3) or similar E. coli strains designed for recombinant protein expression are appropriate. These strains lack certain proteases that might degrade the target protein.

  • Vector design considerations:

    • Include an N-terminal His-tag for purification purposes

    • Incorporate a strong inducible promoter (such as T7) to control expression

    • Consider codon optimization if expression levels are suboptimal

  • Expression conditions:

    • Induction at lower temperatures (16-25°C) may improve proper folding

    • For membrane proteins like nuoK, longer induction times at lower inducer concentrations can enhance proper membrane integration

    • Supplementation with appropriate cofactors may be necessary depending on experimental goals

  • Extraction method:

    • Membrane proteins require detergent-based extraction

    • Gentle cell lysis methods are recommended to maintain protein integrity

E. coli has been successfully used to express full-length D. radiodurans nuoK (1-103aa) with an N-terminal His-tag , demonstrating that despite being a membrane protein, it can be produced in sufficient quantities for research applications.

What role might nuoK play in D. radiodurans' extraordinary radiation resistance?

The potential role of nuoK in D. radiodurans' radiation resistance involves several interconnected mechanisms:

  • Energy metabolism maintenance: As part of the respiratory chain, nuoK contributes to maintaining energy production even under stress conditions. This is crucial for powering DNA repair and other stress response mechanisms that contribute to D. radiodurans' ability to withstand radiation doses thousands of times higher than what would kill other organisms .

  • Interaction with the antioxidant system: D. radiodurans possesses a unique manganese-based antioxidant system. The bacterium's extraordinary resistance involves simple metabolites that combine with manganese to form powerful antioxidants . The respiratory chain, including nuoK, may interact with this system, potentially influencing the redox state of the cell and contributing to radiation resistance.

  • Genomic context and expression regulation: Research on D. radiodurans' chromosome organization reveals that many upregulated genes under radiation stress are located near specific chromosomal interaction domain (CID) boundaries . Although not specifically mentioned in the search results, the positioning of the nuoK gene (DR_1495) within the genome's spatial organization might influence its expression under radiation stress conditions.

Experimental approaches to investigate this relationship could include:

  • Comparing respiratory activity in wild-type and nuoK mutant strains under radiation stress

  • Analyzing changes in nuoK expression and protein levels before and after radiation exposure

  • Examining interactions between nuoK and components of the manganese-based antioxidant system

How can researchers effectively purify recombinant D. radiodurans nuoK while maintaining its native structure?

Purifying membrane proteins like nuoK presents significant challenges. A methodological approach for effective purification includes:

  • Optimized extraction protocol:

    • Use mild detergents (DDM, LMNG, or similar) for initial solubilization

    • Consider a staged extraction approach, beginning with a low detergent concentration

    • Include protease inhibitors throughout the purification process

    • Maintain cold conditions (4°C) during all purification steps

  • Affinity chromatography optimization:

    • Utilize the N-terminal His-tag for immobilized metal affinity chromatography (IMAC)

    • Develop a gradient elution protocol to minimize co-purification of contaminants

    • Consider adding low concentrations of detergent to all chromatography buffers

  • Detergent exchange and protein stabilization:

    • After initial purification, consider exchanging to a more stabilizing detergent

    • Evaluate the addition of lipids or lipid-like molecules to stabilize the protein

    • Test different buffer compositions for optimal stability

  • Quality assessment:

    • Use SDS-PAGE to confirm purity (>90% is achievable)

    • Employ circular dichroism or similar techniques to verify secondary structure

    • Consider functional assays to confirm activity of the purified protein

For researchers interested in structural studies, reconstitution into nanodiscs or similar membrane mimetics may provide a more native-like environment than detergent micelles alone.

How does the chromosomal organization around the nuoK gene (DR_1495) change under radiation stress?

Recent research on D. radiodurans' chromosome conformation provides insights into how radiation stress affects gene organization:

  • Changes in chromosomal interaction domains (CIDs): Under UV irradiation, D. radiodurans exhibits reduced short-range chromosome interactions, and smaller CIDs merge to form larger domains . This reorganization might affect the regulatory environment of genes involved in stress response, potentially including nuoK.

  • Relationship to gene expression: Studies have found that upregulated genes under radiation stress are significantly enriched near specific CID boundaries . The position of nuoK (DR_1495) relative to these boundaries could influence its expression pattern under radiation stress.

  • Role of nucleoid-associated proteins: Nucleoid-associated proteins like DrEbfC may modulate the efficiency of metabolic pathways by altering local chromosome structure . This could include pathways involving nuoK, potentially affecting respiratory function under stress conditions.

Research methodologies to investigate these relationships could include:

  • Chromosome conformation capture (3C) technology to analyze the spatial positioning of the nuoK gene before and after radiation exposure

  • Integration of transcriptomic data to correlate changes in chromosome structure with nuoK expression levels

  • Analysis of the binding patterns of nucleoid-associated proteins near the nuoK locus

How does nuoK contribute to D. radiodurans' metabolic adaptation to oxidative stress?

The contribution of nuoK to metabolic adaptation under oxidative stress involves several interconnected pathways:

  • Respiratory chain modulation: As part of the NDH-1 complex, nuoK may help regulate electron flow through the respiratory chain under oxidative stress conditions, potentially minimizing the production of additional reactive oxygen species.

  • Integration with stress response systems: Research on D. radiodurans reveals that knockout of certain regulatory factors (like DrEbfC) results in down-regulation of genes involved in respiration and increased sensitivity to oxidative stress . This suggests a connection between respiratory components like nuoK and oxidative stress resistance.

  • Metabolic flux redistribution: Studies on D. radiodurans mutants show that changes in chromosomal structure can affect the expression of genes involved in oxidative phosphorylation, leading to redistributed metabolic flux and altered energy production . NuoK, as part of the respiratory complex, would be directly involved in these processes.

A table of potential experimental approaches to study nuoK's role in oxidative stress adaptation:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.