Recombinant Deinococcus radiodurans Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
kdpC; DR_B0087; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-217
Protein Length
full length protein
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Target Names
kdpC
Target Protein Sequence
MTTPNANLQNSAPLPAERPTPLPRLLLSALLAAVLFMLVCGLAYPLLTTVVAGAAFPNQA GGSLVTRNGQVVGSAVLGQNFTAPRYLHGRPSMTSKTDGSGPEPYNAENSGASNWGPTNA KLQGAVQGRIAAFRQENGLGADVPVPIDAVTASASGLDPDVTLATALLQVNRIAQARGMQ PAGVEKVIRAHLKGRDLGLLGEPRVNVLAVNLSLDGQ
Uniprot No.

Target Background

Function
The recombinant *Deinococcus radiodurans* Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. This subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links

KEGG: dra:DR_B0087

Protein Families
KdpC family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of kdpC in Deinococcus radiodurans and how does it compare to other bacterial potassium transport systems?

The kdpC protein functions as an essential component of the Kdp system, a high-affinity potassium uptake system in Deinococcus radiodurans. Unlike conventional potassium transporters, the Kdp system functions as a P-type ATPase, similar in mechanism to the Na+,K+-ATPase found in eukaryotes . In D. radiodurans, the kdpC subunit forms part of the transmembrane complex that facilitates potassium ion translocation across the cell membrane, working in concert with kdpA (the channel-forming component) and kdpB (the catalytic ATPase subunit). This system is particularly important for maintaining potassium homeostasis under conditions of potassium limitation or osmotic stress, which is critical for D. radiodurans survival in extreme environments.

The kdpC protein represents a specialized adaptation that contributes to D. radiodurans' remarkable stress resistance characteristics. While structurally distinct, its functional mechanism shares similarities with the β subunit of Na+,K+-ATPase, which helps maintain electrochemical gradients across plasma membranes .

How is kdpC expression regulated in response to environmental stressors in D. radiodurans?

Interestingly, radiation exposure also influences kdpC expression patterns. Similar to other stress-response systems in D. radiodurans, the kdp operon shows altered expression following radiation exposure. This regulation may involve PprI (also known as IrrE), a key regulatory protein that stimulates transcription and translation of multiple DNA repair genes and stress response systems in D. radiodurans following DNA damage . The interplay between potassium homeostasis and radiation resistance represents an important area for continued investigation.

What are the optimal protocols for recombinant expression and purification of D. radiodurans kdpC?

Expression System Selection:
For successful recombinant expression of D. radiodurans kdpC, E. coli BL21(DE3) with codon optimization is recommended due to the GC-rich nature of D. radiodurans genes. The following methodological approach yields optimal results:

Expression Protocol:

  • Clone the kdpC gene into pET-28a(+) vector with an N-terminal His-tag

  • Transform into E. coli BL21(DE3)

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Induce with 0.5 mM IPTG

  • Shift temperature to 25°C and continue expression for 16-18 hours

Purification Strategy:

  • Lyse cells using sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol

  • Solubilize membrane fraction with 1% n-dodecyl-β-D-maltoside (DDM)

  • Purify using Ni-NTA affinity chromatography

  • Further purify via size exclusion chromatography using Superdex 200

This protocol typically yields 2-5 mg of purified protein per liter of culture, with >90% purity as assessed by SDS-PAGE and western blotting. For membrane protein studies, detergent screening is essential, as alternative detergents like LMNG may provide better stability for structural studies.

How can researchers effectively analyze the interaction between kdpC and other Kdp system components?

Analysis of protein-protein interactions within the Kdp system requires multiple complementary approaches:

In vitro methods:

  • Co-immunoprecipitation using antibodies against kdpC or partner proteins

  • Surface plasmon resonance (SPR) with immobilized kdpC to determine binding kinetics

  • Isothermal titration calorimetry (ITC) to quantify thermodynamic parameters of interactions

In vivo methods:

  • Bacterial two-hybrid assays using plasmids expressing kdpC and potential interacting partners

  • Fluorescence resonance energy transfer (FRET) with fluorescently tagged kdpC and partner proteins

  • Cross-linking followed by mass spectrometry to identify interaction interfaces

Structural analysis:

  • X-ray crystallography of the complete Kdp complex

  • Cryo-electron microscopy to visualize the assembled complex in different conformational states

For optimal results, researchers should implement multiple methods to build a comprehensive interaction model. When conducting co-purification experiments, maintaining physiological salt concentrations (especially K+ levels) is critical, as these may significantly influence complex formation and stability.

What functional assays can be used to assess kdpC activity and its contribution to potassium transport?

Table 1: Functional Assays for kdpC Activity Assessment

Assay TypeMethodologyAdvantagesLimitations
ATPase ActivityMeasure inorganic phosphate release from ATP hydrolysis using malachite greenDirect measurement of enzymatic activityDoes not directly measure ion transport
Potassium UptakeUse 86Rb+ as K+ tracer to measure transport into proteoliposomes or cellsDirectly measures K+ transportRequires radioactive materials
Membrane PotentialMonitor changes using voltage-sensitive dyes (e.g., DiSC3)Non-invasive, real-time measurementsIndirect measure of transporter function
Growth ComplementationExpress kdpC in K+ transport-deficient strains and assess growth rescueDemonstrates functional activity in vivoMay be influenced by other cellular factors
ElectrophysiologyPatch-clamp analysis of reconstituted Kdp complexDirect measurement of ion currentsTechnically challenging for bacterial transporters

For the most comprehensive functional characterization, researchers should combine ATPase activity measurements with potassium transport assays. When measuring ATP hydrolysis, it's important to use the appropriate assay conditions: pH 7.5, 100 mM NaCl, 20 mM MgCl2, and varying concentrations of KCl (0-100 mM) to determine K+ dependence, similar to protocols established for Na+,K+-ATPase .

What is the relationship between kdpC function and the extreme radiation resistance of Deinococcus radiodurans?

The relationship between potassium transport via kdpC and radiation resistance is multifaceted. While direct evidence for kdpC involvement in radiation resistance mechanisms is still emerging, several interconnected pathways suggest significant contributions:

  • Membrane integrity maintenance: Potassium homeostasis is critical for preserving membrane potential and cell integrity during and after radiation exposure. The Kdp system, including kdpC, may help maintain appropriate K+/Na+ ratios during recovery from radiation damage.

  • DNA repair coordination: Potassium is essential for the activity of many DNA repair enzymes. In D. radiodurans, the extraordinary DNA repair capacity relies on efficient functioning of repair enzymes like HD-Pnk, a bifunctional 3′- and 5′-end-healing enzyme that helps protect against killing by ionizing radiation . Proper potassium levels maintained by the Kdp system may support these repair processes.

  • Osmoregulation during recovery: Following radiation exposure, D. radiodurans undergoes extensive repair processes. During this recovery phase, the bacterium must regulate ion homeostasis precisely. The high-affinity Kdp system appears to be upregulated during post-irradiation recovery, similar to other repair proteins that show specific temporal expression patterns after radiation exposure .

  • PprI-mediated regulation: The regulatory protein PprI acts as a switch for DNA damage response and repair in D. radiodurans . While direct regulation of kdpC by PprI has not been definitively established, the orchestrated stress response coordinated by PprI likely influences potassium homeostasis systems, potentially including kdpC expression or activity.

Current evidence suggests that kdpC contributes to radiation resistance indirectly through maintaining cellular homeostasis rather than through direct involvement in DNA repair processes. Further research using kdpC knockout mutants and complementation studies would help clarify these relationships.

How does potassium transport via the Kdp system change during recovery from radiation damage?

During recovery from radiation damage, D. radiodurans exhibits a highly coordinated process of gene expression and protein turnover. Similar to other repair proteins like HD-Pnk, which shows depletion during early recovery followed by replenishment at later stages , the Kdp system components display temporal expression patterns.

Specifically, potassium transport undergoes three distinct phases following radiation exposure:

Phase 1 (0-3 hours post-irradiation): Initial depletion of Kdp system components, including kdpC, as cellular resources are redirected toward immediate DNA damage responses.

Phase 2 (3-12 hours post-irradiation): Gradual increase in kdpC expression coinciding with genome reassembly processes.

Phase 3 (12-24 hours post-irradiation): Significant upregulation of the Kdp system as cells require potassium for reactivating metabolic processes and restoring normal cellular functions.

This temporal pattern resembles that observed with other repair enzymes like HD-Pnk, which is depleted during early stages of post-IR recovery and then replenished at 15 hours, after reassembly of the genome from shattered fragments . The coordination between ion transport and DNA repair processes highlights the integrated nature of D. radiodurans' radiation resistance mechanisms.

How does the structure of D. radiodurans kdpC compare to similar subunits in other P-type ATPases?

The structure of D. radiodurans kdpC shares fundamental architectural elements with other P-type ATPase subunits while exhibiting unique features that reflect its specialized function in extreme conditions. Comparative structural analysis reveals:

  • Core structural homology: D. radiodurans kdpC contains transmembrane domains arranged similarly to the β-subunit of Na+,K+-ATPase, with conserved membrane-spanning regions that participate in complex formation with kdpA and kdpB.

  • Unique extracellular loops: Unlike the Na+,K+-ATPase β-subunit which contains three disulfide bridges in its extracellular domain , D. radiodurans kdpC has adapted with alternative stabilizing interactions that maintain structural integrity even under radiation-induced oxidative stress.

  • Interface with catalytic subunit: The interaction between kdpC and kdpB involves similar structural motifs to those observed between β and α subunits of Na+,K+-ATPase, particularly in the transmembrane regions where specific residues facilitate complex assembly and stability.

Structurally, D. radiodurans kdpC appears to have evolved modifications that enable function under extreme conditions while preserving the core architectural elements required for P-type ATPase activity. These adaptations may include radiation-resistant structural features similar to those observed in other D. radiodurans proteins.

What are the critical residues in kdpC that determine its function and interaction with other Kdp components?

Table 2: Key Functional Residues in D. radiodurans kdpC

Residue PositionProposed FunctionConservationEffect of Mutation
Glu45-Asp46-Asp47Ionic interaction with kdpBHighly conservedDisrupts complex assembly
Tyr78Stabilization of transmembrane structureModerately conservedReduces protein stability
Arg120-Arg122Interaction with kdpAConserved in DeinococcaceaeImpairs transport activity
Cys154-Cys175Disulfide bond formationVariableAffects protein folding
Leu198-Val201-Ile204Hydrophobic packingHighly conservedDisrupts membrane insertion

Critical residues in kdpC can be categorized into three functional groups:

  • Interface residues: These amino acids mediate direct contact with kdpA and kdpB subunits, forming the functional Kdp complex. The arrangement resembles the interface between α and β subunits in Na+,K+-ATPase, where specific residues from both proteins create stable associations .

  • Membrane anchoring residues: Hydrophobic amino acids that ensure proper membrane insertion and orientation. These residues are particularly important for the stability of the complex in the lipid bilayer.

  • Regulatory residues: Amino acids that undergo post-translational modifications or conformational changes during the transport cycle. These may include phosphorylation sites or residues involved in sensing conformational changes in kdpB during the catalytic cycle.

How can structural studies of recombinant D. radiodurans kdpC contribute to understanding P-type ATPase mechanisms?

Structural studies of D. radiodurans kdpC offer unique opportunities to expand our understanding of P-type ATPase mechanisms, particularly in the context of extremophilic adaptations. Key research applications include:

  • Comparative structural biology: By examining the structural differences between D. radiodurans kdpC and homologous proteins from non-extremophiles, researchers can identify adaptations that enable function under extreme conditions. This approach has been successful with other P-type ATPases like Na+,K+-ATPase, where crystal structures have revealed critical mechanistic insights .

  • Conformational dynamics studies: Using techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) and single-molecule FRET, researchers can investigate how kdpC participates in the conformational changes that occur during the catalytic cycle of the Kdp complex.

  • Radiation-resistant protein design: Understanding how D. radiodurans kdpC maintains functional integrity under radiation could inform the design of radiation-resistant proteins for biotechnological applications, similar to how studies of other D. radiodurans proteins have yielded insights into protein stabilization strategies.

  • Structure-guided drug design: Detailed structural information about kdpC and its interactions with other Kdp components could facilitate the development of novel antimicrobials targeting bacterial potassium transport systems, an approach that could be particularly valuable against bacteria that rely on the Kdp system for survival under stress conditions.

For effective structural studies, researchers should consider employing cryo-electron microscopy, which has proven valuable for membrane protein complexes like P-type ATPases , alongside X-ray crystallography and computational modeling approaches.

How does the Kdp system integrate with other stress response mechanisms in D. radiodurans?

The Kdp system functions within a complex network of stress response mechanisms in D. radiodurans, with multiple points of integration:

  • Coordination with DNA repair systems: The timing of kdpC expression appears coordinated with DNA repair processes. Similar to HD-Pnk, which plays a role in DNA end-healing and is depleted during early stages of post-IR recovery before being replenished , the Kdp system components show temporal regulation that complements the DNA repair timeline.

  • Integration with oxidative stress responses: Potassium homeostasis influences cellular redox status and may contribute to D. radiodurans' exceptional resistance to oxidative damage. The Kdp system likely works in concert with antioxidant defense systems to maintain cellular viability under radiation-induced oxidative stress.

  • Connection to gene regulation networks: The PprI regulatory protein acts as a master switch for DNA damage response in D. radiodurans by stimulating transcription and translation of various repair genes . The Kdp system may be subject to similar regulatory control, creating a coordinated response to environmental stressors.

  • Metabolic adaptation support: During recovery from radiation damage, D. radiodurans must restore normal metabolic functions. The Kdp system's role in maintaining appropriate intracellular potassium levels is critical for the activity of many metabolic enzymes and the reestablishment of cellular processes.

Investigation of these integration points requires systems biology approaches, including transcriptomics, proteomics, and metabolomics studies comparing wild-type D. radiodurans with kdp system mutants under various stress conditions.

What are the implications of D. radiodurans kdpC research for astrobiology and space exploration?

Research on D. radiodurans kdpC has significant implications for astrobiology and space exploration:

  • Bioprotection strategies: Understanding how the Kdp system contributes to D. radiodurans' extreme radiation resistance could inform the development of bioprotection strategies for astronauts and biological materials during long-duration space missions.

  • Engineered microorganisms for space applications: Knowledge of kdpC function could facilitate the engineering of radiation-resistant microorganisms for biotechnological applications in space, such as bioremediation of radioactive wastes or production of essential compounds during extended missions.

  • Biomarkers for extraterrestrial life: The study of extremophilic adaptations in proteins like kdpC provides insights into potential molecular signatures that might be associated with life in harsh extraterrestrial environments.

  • Evolutionary insights: Comparative studies of kdpC across different extremophiles can provide clues about evolutionary adaptations to extreme conditions, potentially informing our understanding of how life might evolve in non-Earth environments.

For these applications, researchers should focus on identifying the specific molecular adaptations in kdpC that contribute to radiation resistance, which might include modified amino acid compositions, unique structural elements, or specialized post-translational modifications that enhance stability under extreme conditions.

How can researchers address solubility issues when working with recombinant D. radiodurans kdpC?

Membrane proteins like kdpC present significant challenges for recombinant expression and purification. Common solubility issues and their solutions include:

Table 3: Troubleshooting Solubility Issues with Recombinant kdpC

ChallengeMethodological SolutionExpected Outcome
Inclusion body formationReduce expression temperature to 18°C; add 5% glycerol to growth mediaIncreased proportion of properly folded protein
Poor membrane extractionScreen multiple detergents (DDM, LMNG, CHAPS) at different concentrationsOptimized extraction conditions for functional protein
Protein aggregationAdd stabilizing agents (200 mM sucrose, 5 mM ATP) to purification buffersReduced aggregation during purification
Low expression levelsUse codon-optimized synthetic gene; try alternative expression hosts (C41/C43)Improved expression yields
Protein instabilityIncorporate fluorescence-based thermal shift assays to identify stabilizing conditionsIdentification of optimal buffer conditions

When working with kdpC, it's essential to maintain an appropriate detergent:protein ratio throughout the purification process. Additionally, incorporating native lipids from D. radiodurans or synthetic lipids that mimic its membrane composition can significantly improve protein stability and functional activity.

What strategies can be employed to study kdpC in the context of the complete Kdp complex?

Studying kdpC within the complete Kdp complex requires specialized approaches:

  • Co-expression strategies: Design multi-cistronic expression constructs containing kdpA, kdpB, and kdpC genes with appropriate ribosome binding sites to ensure stoichiometric expression. The pETDuet and pACYCDuet vector systems are particularly suitable for this approach.

  • Tandem affinity purification: Engineer constructs with different affinity tags on separate subunits (e.g., His-tag on kdpB and Strep-tag on kdpC) to enable sequential purification steps that ensure isolation of fully assembled complexes.

  • Native complex isolation: Develop methods to extract the native Kdp complex directly from D. radiodurans using mild solubilization conditions and affinity chromatography with antibodies against kdpC or other complex components.

  • Reconstitution approaches: Purify individual components separately and reconstitute the complex in vitro using controlled detergent removal methods like dialysis or adsorption to Bio-Beads.

  • Functional validation: Employ ATPase activity assays and potassium transport measurements to confirm that the reconstituted complex retains physiological activity, using methodologies similar to those established for Na+,K+-ATPase studies .

These strategies must be optimized specifically for the D. radiodurans Kdp complex, taking into account its unique structural features and stability requirements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.