Recombinant Deinococcus radiodurans Probable disulfide formation protein (DR_0754)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DR_0754; Probable disulfide formation protein; Disulfide oxidoreductase; Thiol-disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Target Names
DR_0754
Target Protein Sequence
MNRDTRLYLAWLVALAATLGSLYFSEIRHFNPCPLCWAQRIFMYPLAVILGIAAFVGDHG VRRYVLPLAALGLGFAIFQNLETWGFVQSIKACTVNAAAACNTPWPVWGTSQDTLNRALT IPVLSMIAFALILALLSWPRQRVTVPESAAVQG
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain proteins.
Database Links

KEGG: dra:DR_0754

STRING: 243230.DR_0754

Protein Families
DsbB family, BdbC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental structure and classification of DR_0754 protein?

The DR_0754 protein from Deinococcus radiodurans is classified as a probable disulfide formation protein, also known as disulfide oxidoreductase or thiol-disulfide oxidoreductase . It belongs to a family of proteins involved in disulfide bond formation, which is critical for protein stability and folding. The protein's UniProt accession number is Q9RWB5 . While the complete structure has not been fully characterized in the provided research data, it likely contains thioredoxin-like domains typical of disulfide oxidoreductases. As a recombinant protein, it is typically expressed in mammalian cell systems with a purity of >85% as verified by SDS-PAGE analysis .

How does the DR_0754 protein contribute to the extreme radiation resistance of D. radiodurans?

The DR_0754 protein likely contributes to D. radiodurans' radiation resistance through its role in maintaining protein structure integrity via disulfide bond management. D. radiodurans exhibits extraordinary resistance to ionizing radiation, ultraviolet radiation, and desiccation through a mechanistic link between resistance, manganese accumulation, and protein protection . Studies have shown that protein-free extracts from D. radiodurans prevent protein oxidation at massive doses of ionizing radiation, suggesting a complex interaction between manganese, phosphate, nucleosides, bases, and peptides . As a disulfide formation protein, DR_0754 may play a crucial role in repairing oxidative damage to proteins by reforming appropriate disulfide bonds in proteins damaged by radiation, working alongside the manganese-metabolite complexes that protect against indirect damage from gamma rays .

What are the optimal storage and handling conditions for recombinant DR_0754 protein?

The recombinant DR_0754 protein requires specific storage and handling protocols to maintain its stability and functional integrity. For liquid formulations, the shelf life is generally around 6 months when stored at -20°C to -80°C, while lyophilized forms maintain stability for approximately 12 months at the same temperature range . Prior to opening, it is recommended to briefly centrifuge the vial to bring the contents to the bottom. For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

For long-term storage, adding glycerol to a final concentration of 5-50% (with 50% being the default recommendation) and aliquoting before storing at -20°C/-80°C is advised . Repeated freeze-thaw cycles should be avoided to preserve protein integrity. Working aliquots can be stored at 4°C for up to one week . These conditions are critical for maintaining the protein's structure and function for experimental use.

What are the recommended approaches for experimental design when studying DR_0754 protein functions?

When designing experiments to study DR_0754 protein functions, researchers should employ a systematic approach based on established experimental design principles. The Taguchi method of experimental design is particularly valuable for optimizing quality while minimizing costs in protein research . This approach would involve identifying key factors affecting DR_0754 function (such as temperature, pH, salt concentration, and potential cofactors) and using orthogonal arrays to efficiently test combinations of these factors.

For comprehensive studies, an integrative mixed methods (IMM) approach is recommended, combining qualitative and quantitative methodologies . This would include:

  • Creating focus questions about DR_0754 function (e.g., its role in radiation resistance)

  • Extracting response codes from initial experiments

  • Creating thematic categories for data organization

  • Dimensionalizing thematic categories via scale coding

  • Performing qualitative-quantitative data analysis

  • Creating comprehensive story lines to explain results

This methodological framework allows for rigorous experimental design that can reveal multifaceted aspects of DR_0754 function, from basic biochemical properties to complex interactions within the cellular context of D. radiodurans.

What assays are most effective for measuring the disulfide oxidoreductase activity of DR_0754?

While specific assays for DR_0754 are not directly mentioned in the provided research data, standard methodological approaches for disulfide oxidoreductases can be applied. Based on the protein's classification as a disulfide formation protein/disulfide oxidoreductase , the following assays would be most effective:

  • Insulin Reduction Assay: This spectrophotometric assay measures the ability of DR_0754 to reduce insulin disulfide bonds, resulting in precipitation of the insulin B chain that can be monitored at 650 nm.

  • DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)) Reduction Assay: This assay monitors the reduction of DTNB to TNB, which can be measured spectrophotometrically at 412 nm, providing a quantitative measure of thiol-disulfide exchange activity.

  • Protein Substrate Oxidation Assays: Using native protein substrates from D. radiodurans and monitoring their oxidation state changes through non-reducing SDS-PAGE or mass spectrometry.

  • RNase A Refolding Assay: Measuring the ability of DR_0754 to catalyze the refolding of reduced, denatured RNase A through the formation of native disulfide bonds.

For optimal results, these assays should be performed under conditions that mimic the intracellular environment of D. radiodurans, particularly with regard to manganese concentration, as manganese accumulation is linked to the radiation resistance mechanisms of this organism .

How can researchers effectively measure DR_0754 protein-protein interactions in the context of radiation stress response?

To effectively measure DR_0754 protein-protein interactions during radiation stress response, researchers should employ multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP): Using antibodies against DR_0754 to pull down protein complexes formed during radiation exposure, followed by mass spectrometry identification of binding partners.

  • Yeast Two-Hybrid (Y2H) Screening: Though traditional, this approach can identify potential interactions between DR_0754 and other proteins involved in radiation response.

  • Bioluminescence Resonance Energy Transfer (BRET) or Fluorescence Resonance Energy Transfer (FRET): These techniques allow monitoring of protein interactions in real-time during radiation exposure.

  • Crosslinking Mass Spectrometry: Chemical crosslinking followed by mass spectrometry analysis can capture transient interactions that occur during radiation response.

  • Surface Plasmon Resonance (SPR): For quantitative analysis of binding kinetics between DR_0754 and potential partner proteins.

Given the unique environment of D. radiodurans cells, researchers should consider including manganese, phosphate, and other components found in D. radiodurans ultrafiltrate in their experimental buffers, as these have been shown to provide radioprotection and may influence protein interactions . Additionally, comparative analysis with radiation-sensitive bacteria would provide valuable control data to distinguish radiation-specific interactions from general stress responses.

How does DR_0754 interact with the manganese-dependent protection system in D. radiodurans?

The interaction between DR_0754 and the manganese-dependent protection system in D. radiodurans represents a fascinating area of research into radiation resistance mechanisms. D. radiodurans has a well-documented system where manganese accumulation plays a critical role in protein protection against radiation damage . The ultrafiltered, protein-free preparations of D. radiodurans cell extracts contain Mn²⁺, phosphate, nucleosides, bases, and peptides, which together prevent protein oxidation at massive doses of ionizing radiation .

DR_0754, as a disulfide formation protein, likely functions within this protection framework by:

  • Repairing Oxidized Proteins: After radiation exposure, DR_0754 may help restore proper disulfide bonds in damaged proteins, complementing the protection provided by manganese-metabolite complexes.

  • Maintaining Redox Homeostasis: Through its thiol-disulfide oxidoreductase activity, DR_0754 likely helps maintain cellular redox balance during and after radiation stress.

  • Synergistic Action with Mn²⁺ Complexes: Research has shown that when Mn²⁺ and orthophosphate are reconstituted in vitro at concentrations approximating those in D. radiodurans cytosol, they interact synergistically with peptides to preserve enzyme activity even at massive radiation doses (50,000 Gy) . DR_0754 may contribute to or benefit from this synergistic protection system.

Methodologically, researchers investigating these interactions should design experiments that monitor both the activity of DR_0754 and the composition of Mn²⁺-metabolite complexes under radiation stress, potentially using techniques such as electron paramagnetic resonance (EPR) spectroscopy to analyze Mn²⁺ complexes alongside protein oxidation state analysis.

What is the expression profile of DR_0754 before and after radiation exposure?

While the search results don't provide specific expression data for DR_0754, we can infer its likely expression pattern based on related proteins in D. radiodurans. Similar to the single-stranded DNA-binding protein (SSB) genes in D. radiodurans, DR_0754 expression might be induced after radiation exposure . The ssb gene in D. radiodurans shows increased expression after irradiation, although it's primarily involved in replication under normal conditions .

To properly characterize the expression profile of DR_0754, researchers should:

  • Perform qRT-PCR Analysis: Quantify DR_0754 mRNA levels at various time points before and after radiation exposure.

  • Western Blot Analysis: Measure protein levels using specific antibodies against DR_0754.

  • Proteomics Approach: Conduct global proteome analysis to place DR_0754 expression changes in the context of other radiation-responsive proteins.

  • Reporter Gene Assays: Fuse the DR_0754 promoter to reporter genes like GFP to visualize expression dynamics in living cells during radiation response.

How does the function of DR_0754 compare with other radiation-resistance proteins in D. radiodurans?

D. radiodurans possesses a complex network of proteins contributing to its extreme radiation resistance. Comparing DR_0754 with other known radiation resistance proteins reveals important functional relationships:

  • Single-Stranded DNA-Binding Proteins (SSB and DdrB): D. radiodurans contains two SSB homologs - the canonical Ssb and a novel pentameric protein DdrB . While DdrB is highly induced upon radiation exposure and is integral to radiation resistance, Ssb is essential for survival and cannot be complemented by DdrB . DR_0754, as a disulfide formation protein, likely works in a complementary manner to these DNA-binding proteins by focusing on protein protection rather than DNA repair.

  • Proteases: D. radiodurans encodes an expanded family of proteases activated by irradiation . These proteases contribute to the pool of peptides needed to form antioxidant Mn²⁺ complexes. DR_0754 may work synergistically with these systems, helping to restore the function of proteins that have been damaged but not degraded.

  • Metabolic Enzymes: D. radiodurans displays unusual metabolic defects that could facilitate the accumulation of protective metabolites . DR_0754 likely operates within this specialized metabolic context, potentially utilizing or affecting the levels of these accumulated metabolites.

The key methodological approach for comparing these functions would involve creating deletion mutants for DR_0754 and other radiation resistance genes, both individually and in combination, followed by comprehensive phenotypic analysis under radiation stress. This would reveal any functional redundancy, synergy, or epistatic relationships between DR_0754 and other radiation resistance determinants.

How does DR_0754 structurally and functionally compare to similar proteins in radiation-sensitive bacteria?

The structural and functional comparison between DR_0754 and homologous proteins in radiation-sensitive bacteria provides valuable insights into the unique radiation resistance mechanisms of D. radiodurans. While specific structural comparisons for DR_0754 are not provided in the search results, we can infer likely differences based on general patterns observed in D. radiodurans proteins:

  • Structural Adaptations: DR_0754, as a disulfide formation protein in an extremely radiation-resistant organism, likely possesses structural adaptations that enhance its stability under radiation stress. These might include higher intrinsic disorder, which can provide flexibility during stress conditions, or additional metal-binding sites that interact with the manganese protection system unique to D. radiodurans .

  • Functional Differences: Research has shown that ultrafiltered, protein-free preparations from radiation-sensitive bacteria were not protective against radiation, unlike those from D. radiodurans . This suggests that even if homologous proteins exist in radiation-sensitive bacteria, they function within fundamentally different cellular environments lacking the protective Mn²⁺-metabolite complexes found in D. radiodurans.

  • Evolutionary Divergence: Comparative sequence analysis would likely reveal evolutionary adaptations specific to DR_0754 compared to homologs in radiation-sensitive bacteria.

Methodologically, researchers should employ:

  • Sequence alignment and phylogenetic analysis

  • Homology modeling of protein structures

  • Heterologous expression of DR_0754 in radiation-sensitive bacteria to assess functional complementation

  • Biochemical assays comparing enzyme kinetics and substrate specificity

This comparative approach would help identify the unique features of DR_0754 that contribute to D. radiodurans' extraordinary radiation resistance.

What are the key differences between recombinant and native DR_0754 protein?

Understanding the differences between recombinant and native DR_0754 protein is crucial for researchers interpreting experimental results and developing applications. Based on general principles of recombinant protein production and the specific information provided about recombinant DR_0754 :

  • Expression System: The recombinant DR_0754 is produced in mammalian cells , whereas the native protein is expressed in D. radiodurans. This difference in expression systems can lead to variations in post-translational modifications, folding, and activity.

  • Structural Modifications: The recombinant version may include affinity tags for purification purposes, though the specific tag information would be determined during the manufacturing process .

  • Purity: The recombinant protein is purified to >85% as determined by SDS-PAGE , whereas the native protein exists in the complex cellular environment of D. radiodurans.

  • Partial vs. Complete Sequence: The recombinant DR_0754 is described as "partial" , suggesting it may not represent the full-length native protein.

  • Functional Context: The native protein functions within the unique cellular environment of D. radiodurans, which includes high manganese concentrations and specific metabolite compositions that contribute to radiation resistance . These conditions are absent for the recombinant protein unless specifically reconstituted.

Researchers should be aware of these differences when designing experiments, particularly when trying to replicate the native functionality of DR_0754. Activity assays should ideally compare the recombinant and native forms, and reconstitution experiments should consider the unique cellular components of D. radiodurans that might be necessary for full functionality.

How can researchers effectively compare the activity of DR_0754 with other thiol-disulfide oxidoreductases from different organisms?

Effective comparison of DR_0754 with other thiol-disulfide oxidoreductases requires a multi-faceted methodological approach that accounts for both enzymatic activity and biological context:

  • Standardized Activity Assays: Researchers should employ standardized biochemical assays such as the insulin turbidity assay or DTNB reduction assay under identical conditions to directly compare catalytic efficiencies (kcat/KM values) across different enzymes.

  • Substrate Specificity Profiling: Using a panel of potential protein substrates to determine if DR_0754 exhibits unique substrate preferences compared to homologous enzymes from other organisms.

  • Stress Resistance Testing: Assessing the stability and activity of different oxidoreductases under conditions mimicking radiation stress, such as exposure to hydrogen peroxide or direct radiation.

  • Complementation Studies: Expressing DR_0754 in heterologous systems lacking native oxidoreductases to assess functional complementation.

  • Reconstitution Experiments: Testing activity in the presence of components found in D. radiodurans ultrafiltrate (Mn²⁺, phosphate, nucleosides, bases, and peptides) to determine if the unique cellular environment of D. radiodurans affects enzyme function.

  • Structural Comparison: Using X-ray crystallography or cryo-EM to resolve structural differences that might explain functional variations.

A particularly valuable approach would be to compare DR_0754 with homologous proteins from both radiation-resistant and radiation-sensitive bacteria to identify specific adaptations associated with radiation resistance. The results could be presented in a comparative table showing key enzymatic parameters, substrate preferences, and stress resistance profiles across different species.

How can DR_0754 be utilized in developing radiation protection strategies for other organisms?

The potential application of DR_0754 in developing radiation protection strategies for other organisms represents a promising area of research based on D. radiodurans' extraordinary radiation resistance. Research has shown that protein-free extracts from D. radiodurans provided radioprotection to both E. coli and human Jurkat T cells , suggesting broad applicability of these mechanisms.

For developing DR_0754-based radiation protection strategies:

  • Ex vivo Application: Following the approach demonstrated with D. radiodurans ultrafiltrate, researchers could test whether purified DR_0754, either alone or in combination with Mn²⁺ and other metabolites, can protect proteins and cells from radiation damage when applied exogenously .

  • Transgenic Expression: Engineering expression of DR_0754 in radiation-sensitive organisms could potentially enhance their radiation resistance, particularly if combined with other components of the D. radiodurans protection system.

  • Therapeutic Development: The findings that D. radiodurans ultrafiltrate protected human Jurkat T cells from radiation suggests potential applications in radiotherapy adjuvants or radiation countermeasures for human use.

  • Synthetic Biology Approaches: Creating minimal protective systems that incorporate DR_0754 along with key components of the manganese-metabolite protection system could yield portable radiation protection modules for various organisms.

Methodologically, researchers should first establish whether DR_0754 alone provides protection or requires the synergistic action of Mn²⁺-metabolite complexes. Dose-response experiments similar to those conducted with D. radiodurans ultrafiltrate on Jurkat T cells would be essential to establish efficacy and optimal concentrations for protection.

What are the challenges in scaling up production of functional recombinant DR_0754 for research applications?

Scaling up production of functional recombinant DR_0754 presents several challenges that researchers must address:

  • Expression System Selection: While the current recombinant DR_0754 is produced in mammalian cells , this system may be costly and difficult to scale. Alternative expression systems (E. coli, yeast, insect cells) should be evaluated for yield, functionality, and cost-effectiveness.

  • Protein Folding and Disulfide Bond Formation: As a disulfide formation protein, DR_0754 likely contains disulfide bonds itself, which can be challenging to form correctly in heterologous expression systems, particularly in the reducing environment of bacterial cytoplasm.

  • Purification Strategy: Current purification achieves >85% purity by SDS-PAGE , but scaling up might require optimized purification protocols that maintain yield while ensuring purity and activity.

  • Stability Enhancement: The current shelf life (6 months for liquid form, 12 months for lyophilized form at -20°C/-80°C) may need improvement for practical research applications, potentially through formulation with stabilizing additives.

  • Functional Validation: Ensuring that scaled-up production maintains the functional properties of the protein, particularly if these depend on the unique manganese-rich environment of D. radiodurans.

Methodologically, researchers should employ a systematic design of experiments approach (such as Taguchi methods ) to optimize production parameters across multiple variables simultaneously. This would involve creating orthogonal arrays to test different expression conditions, purification strategies, and stabilization formulations to identify optimal combinations that maximize yield, purity, stability, and functionality.

A Comparative Analysis of DR_0754 Expression Systems

Expression SystemAdvantagesDisadvantagesTypical YieldPurification Complexity
Mammalian cells (current) Proper folding, PTMsExpensive, slow growthModerateHigh
E. coliLow cost, rapid growthImproper folding, inclusion bodiesHighModerate
YeastProper folding, cost-effectiveMedium yield, glycosylation differencesModerateModerate
Insect cellsProper folding, high yieldMore expensive than microbial systemsHighModerate
Cell-free systemsRapid, no cell viability issuesVery expensive, limited scalabilityLowLow

How might DR_0754 function be modulated to enhance its protective effects in radiation-sensitive organisms?

Modulating DR_0754 function to enhance its protective effects in radiation-sensitive organisms requires sophisticated protein engineering approaches based on understanding its structure-function relationship. Several strategies could be explored:

  • Protein Engineering:

    • Site-directed mutagenesis to enhance catalytic efficiency

    • Creation of chimeric proteins combining domains from DR_0754 and other oxidoreductases

    • Directed evolution to select variants with enhanced radiation protection properties

  • Optimized Expression:

    • Developing inducible expression systems that upregulate DR_0754 in response to radiation

    • Co-expression with other components of the D. radiodurans protection system, particularly those involved in manganese metabolism

  • Environmental Modulation:

    • Supplementing growth media with manganese and small molecules found in D. radiodurans ultrafiltrate to mimic the protective environment

    • Manipulating redox conditions to optimize DR_0754 activity

  • Targeting and Localization:

    • Adding targeting sequences to direct DR_0754 to cellular compartments most vulnerable to radiation damage

    • Engineering membrane-permeable variants that can be applied exogenously

For methodological implementation, researchers should first conduct structure-function analyses to identify critical residues and domains. Then, a systematic approach to protein modification followed by functional screening under radiation stress would identify beneficial modifications. The experimental design should include appropriate controls and standardized radiation exposure conditions to reliably assess improvements in protection.

What are the most promising future research directions for understanding DR_0754 function in radiation resistance?

The exploration of DR_0754 function in radiation resistance offers several promising research directions that could significantly advance our understanding of extreme radiation resistance mechanisms. Based on the current knowledge about D. radiodurans and its protection systems , the following areas deserve particular attention:

  • Structural Biology: Determining the three-dimensional structure of DR_0754 through X-ray crystallography or cryo-EM would provide crucial insights into its mechanism of action and potential interactions with other components of the radiation protection system.

  • Systems Biology Approach: Investigating DR_0754 within the broader context of D. radiodurans' protection network, particularly its relationship with the manganese-metabolite complexes and the expanded family of proteases .

  • In vivo Dynamics: Using advanced imaging techniques to track DR_0754 localization and activity in living D. radiodurans cells before, during, and after radiation exposure.

  • Synthetic Biology Applications: Engineering minimal systems that incorporate DR_0754 and other key components to confer radiation resistance on sensitive organisms.

  • Comparative Genomics and Evolution: Exploring how DR_0754 and related proteins have evolved across radiation-resistant and sensitive organisms to identify key adaptations.

These research directions should employ rigorous experimental design methodologies, such as the Taguchi method or integrative mixed methods approaches , to efficiently explore the multifaceted aspects of DR_0754 function in radiation resistance.

How might advances in understanding DR_0754 contribute to broader applications in radiation biology?

Advances in understanding DR_0754 have the potential to contribute significantly to broader applications in radiation biology, extending far beyond the specific context of D. radiodurans research:

  • Radiation Countermeasures: The demonstrated ability of D. radiodurans extracts to protect human Jurkat T cells suggests that DR_0754, particularly in combination with the manganese-metabolite protection system, could lead to novel radioprotective agents for medical applications.

  • Space Exploration: Enhanced understanding of how DR_0754 contributes to radiation resistance could inform strategies for protecting astronauts and equipment during long-duration space missions.

  • Radiotherapy Enhancement: Knowledge of protein protection mechanisms involving DR_0754 could lead to approaches that selectively protect normal tissues while maintaining sensitivity of tumor tissues during radiotherapy.

  • Environmental Bioremediation: Engineering radiation resistance into organisms used for bioremediation of radioactively contaminated sites could improve their efficacy and survival.

  • Fundamental Understanding of Protein Oxidation: Insights into how DR_0754 manages disulfide bonds and protein oxidation states under extreme conditions will advance our basic understanding of redox biology.

From a methodological perspective, researchers should adopt interdisciplinary approaches that combine molecular biology, structural biology, systems biology, and synthetic biology to fully realize these potential applications. The innovative integration of quantitative and qualitative research methods would be particularly valuable for translating basic insights into practical applications.

What interdisciplinary approaches might yield the most comprehensive understanding of DR_0754 and its applications?

Achieving a comprehensive understanding of DR_0754 and maximizing its potential applications requires innovative interdisciplinary approaches that bridge multiple scientific disciplines:

  • Integrative Mixed Methods Approach: Following the six-step methodology outlined in search result would provide a rigorous framework for combining qualitative and quantitative data about DR_0754, creating a more holistic understanding than either approach alone.

  • Structural Biology + Computational Biology: Combining experimental structure determination with molecular dynamics simulations and computational modeling to understand DR_0754 function at atomic resolution.

  • Systems Biology + Synthetic Biology: Using systems-level analysis to understand DR_0754 in its native context, then applying synthetic biology approaches to reconstitute minimal functional systems.

  • Radiation Biology + Protein Biochemistry: Integrating radiation exposure studies with detailed biochemical analysis of DR_0754 activity and modifications.

  • Evolutionary Biology + Comparative Genomics: Tracing the evolutionary history of DR_0754-like proteins across radiation-resistant and sensitive organisms to identify critical adaptations.

  • Biophysics + Analytical Chemistry: Employing advanced spectroscopic and analytical techniques to characterize the interactions between DR_0754, manganese ions, and metabolites in the cellular environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.