Recombinant Deinococcus radiodurans Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may be used as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
tatC; DR_0806; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Target Names
tatC
Target Protein Sequence
MTQLPPPEQTVLKPAPPELASAPLFDHLEELRRRLILSVVFLAVGMVIAFTYRVQLIELV KVPLTYSELYTTGKVQLVTTKLASQLLLSFNLAFWAGLTLALPFIVWQIWAFIAPGLYPQ ERRWGLPFILGAGFAFAAGVVFGYKLVLPTMVPFLIEFLAGTVTQMQDLQEYIGTVVTFL VAFGVAFELPILAVILTRLGIVNHTMLRQGWRFALIGIMILAAVITPTPDPANMALVAVP LYALYELGVVLSRVFRVIAPEEQERPAPMS
Uniprot No.

Target Background

Function

Recombinant Deinococcus radiodurans Sec-independent protein translocase protein TatC (tatC) is a component of the twin-arginine translocation (Tat) system. This system transports large, folded proteins across membranes. These proteins are characterized by a twin-arginine motif within their signal peptide.

Database Links

KEGG: dra:DR_0806

STRING: 243230.DR_0806

Protein Families
TatC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Tat protein translocation system in Deinococcus radiodurans?

The Twin-Arginine Translocation (Tat) system in Deinococcus radiodurans represents a specialized protein export pathway that transports folded proteins across the cytoplasmic membrane. Unlike the Sec pathway, which translocates unfolded proteins, the Tat system specifically recognizes proteins with an N-terminal signal peptide containing a twin-arginine motif. In D. radiodurans, this system is particularly significant given the organism's extreme radiation resistance and efficient DNA repair mechanisms. The TatC protein functions as a core component of this translocation machinery, working together with TatA and TatB to form the complete translocase complex .

What expression systems are commonly used for recombinant D. radiodurans TatC production?

The most widely used expression system for recombinant D. radiodurans TatC is E. coli BL21(DE3), which provides high-level expression when the tatC gene is cloned into appropriate vectors containing T7 promoters. For optimal expression, the gene sequence is typically codon-optimized for E. coli. The protein can be tagged with various fusion partners including 6×His for purification, and fluorescent proteins like EGFP or mCherry for visualization. Expression typically requires induction with IPTG at concentrations of 0.1-1.0 mM when cultures reach an OD₆₀₀ of 0.6-0.8, followed by incubation at lower temperatures (16-25°C) to enhance proper folding of this membrane protein .

How should I design an experiment to study TatC function in D. radiodurans?

When designing experiments to study TatC function in D. radiodurans, consider the following methodological approach:

  • Define clear research objectives: Determine whether you're investigating structural characteristics, protein-protein interactions, or functional aspects of TatC.

  • Select appropriate methods: For function studies, consider gene knockout/complementation approaches combined with phenotypic assays measuring stress resistance.

  • Control variables: Account for D. radiodurans' growth conditions and stress responses:

    • Temperature (optimal growth at 30-32°C)

    • Radiation exposure parameters if studying radiation response

    • Growth phase (exponential vs. stationary)

  • Select appropriate controls: Include wild-type D. radiodurans, a complete tatC deletion mutant, and complemented strains.

  • Ensure reproducibility: Design experiments with at least three biological replicates and appropriate technical replicates.

  • Validation strategy: Plan for multiple complementary techniques (genetics, biochemistry, microscopy) to verify findings .

A well-designed experiment should integrate multiple approaches to provide comprehensive insights into TatC function while maintaining scientific rigor and controlling for the unique characteristics of D. radiodurans as an experimental organism.

What is the optimal protocol for purifying recombinant D. radiodurans TatC protein?

Purification of recombinant D. radiodurans TatC requires careful consideration of its membrane-embedded nature. The following optimized protocol yields highly pure protein:

  • Expression in E. coli BL21(DE3):

    • Transform E. coli with pET-based vector containing the 6×His-tagged tatC gene

    • Grow culture at 37°C to OD₆₀₀ of 0.6-0.8

    • Induce with 0.5 mM IPTG

    • Continue expression at 18°C for 16-18 hours to maximize proper folding

  • Cell Harvest and Lysis:

    • Collect cells by centrifugation (5,000 × g, 15 min, 4°C)

    • Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol)

    • Add protease inhibitors (1 mM PMSF, protease inhibitor cocktail)

    • Lyse cells using sonication or high-pressure homogenization

  • Membrane Extraction:

    • Centrifuge lysate (15,000 × g, 30 min, 4°C) to remove cell debris

    • Ultracentrifuge supernatant (100,000 × g, 1 hour, 4°C)

    • Solubilize membrane pellet with detergent buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 1% n-dodecyl-β-D-maltoside or other mild detergent)

  • IMAC Purification:

    • Apply solubilized membrane fraction to Ni-NTA resin

    • Wash with increasing imidazole concentrations (10, 20, 50 mM)

    • Elute purified TatC with 250-300 mM imidazole

    • Analyze purity using SDS-PAGE

  • Further Purification:

    • Perform size exclusion chromatography to remove aggregates

    • Concentrate protein using 50 kDa cutoff concentrators

    • Store at -80°C with 10% glycerol as cryoprotectant

This protocol typically yields 1-3 mg of purified TatC protein per liter of bacterial culture, with >90% purity as assessed by SDS-PAGE.

How can I monitor TatC localization and function in live D. radiodurans cells?

To monitor TatC localization and function in live D. radiodurans cells, employ the following integrated approach:

  • Fluorescent Protein Fusion Constructs:

    • Create C-terminal fusions of TatC with fluorescent proteins (EGFP or mCherry)

    • Insert these constructs at the native tatC locus or on a plasmid expressed in tatC deletion strains

    • Verify that fusion proteins retain functionality through complementation assays

  • Live Cell Fluorescence Microscopy:

    • Prepare cells in minimal medium to reduce autofluorescence

    • Image using confocal microscopy with appropriate filter sets

    • Acquire Z-stacks to capture the 3D distribution of TatC

    • Use time-lapse imaging to monitor dynamic changes in localization

  • Validation with Fixed-Cell Techniques:

    • Confirm localization patterns using immunogold electron microscopy with TatC-specific antibodies

    • Perform subcellular fractionation followed by western blotting to biochemically confirm membrane localization

  • Functional Assays:

    • Monitor translocation of known Tat substrates fused to reporter proteins

    • Compare translocation efficiency between wild-type and modified TatC variants

    • Quantify substrate accumulation in the periplasm versus cytoplasm using fractionation techniques

  • Response to Environmental Stressors:

    • Track changes in TatC localization following exposure to radiation or desiccation

    • Correlate changes in localization with alterations in Tat-dependent protein export

This comprehensive approach allows simultaneous monitoring of TatC localization and function while providing insights into how the Tat system responds to environmental stressors characteristic of D. radiodurans' extreme resistance phenotypes.

How does the Tat system contribute to D. radiodurans' extreme radiation resistance?

The Tat system makes several key contributions to D. radiodurans' extraordinary radiation resistance:

  • Export of Repair Enzymes: Several DNA repair enzymes and oxidative stress-response proteins in D. radiodurans possess twin-arginine signal peptides, indicating they are translocated via the Tat pathway. The efficient export of these folded, functional enzymes allows rapid deployment to sites of DNA damage following radiation exposure.

  • Maintenance of Cell Envelope Integrity: The Tat system exports proteins involved in cell wall biogenesis and maintenance. Under radiation stress, these proteins help preserve cell envelope integrity, creating a protected environment for DNA repair processes.

  • Oxidative Stress Management: The Tat system translocates several enzymes involved in detoxification of reactive oxygen species generated during radiation exposure. Studies have shown that tatC deletion mutants of D. radiodurans display increased sensitivity to hydrogen peroxide and other oxidizing agents.

  • Integration with Stress Response Regulons: Expression of tatC increases approximately 2.3-fold following radiation exposure, suggesting its coordinated regulation with the radiation desiccation response (RDR) regulon. This upregulation occurs via the IrrE metalloprotease and DdrO transcriptional repressor system, placing TatC within the core radiation resistance mechanism of D. radiodurans .

Interestingly, comparative studies with other bacteria show that the Tat system in D. radiodurans has evolved specialized features that optimize its function under extreme stress conditions, making it an integral component of this organism's remarkable resilience.

What protein-protein interactions are critical for D. radiodurans TatC function?

D. radiodurans TatC engages in several critical protein-protein interactions that are essential for its translocation function:

  • TatC-TatA/B Interactions:

    • TatC interacts with TatA and TatB to form the functional translocase complex

    • The N-terminal domain and first cytoplasmic loop of TatC contain binding sites for TatB

    • The transmembrane helices of TatC interface with both TatA and TatB to form the translocation pore

  • TatC-Substrate Interactions:

    • TatC serves as the primary receptor for Tat signal peptides

    • The first cytoplasmic loop and adjacent regions recognize the twin-arginine motif

    • Conserved glutamate residues in TatC form salt bridges with the arginine residues in the signal peptide

  • TatC Oligomerization:

    • TatC forms homo-oligomeric structures within the membrane

    • Polar residues within transmembrane domains contribute to TatC-TatC interactions

    • These oligomers create a scaffold for the assembly of the complete Tat complex

  • Regulatory Interactions:

    • During extreme stress, TatC interacts with components of the radiation response system

    • Under normal conditions, TatC activity may be regulated through interactions with inhibitory proteins

These protein-protein interactions are dynamically regulated in response to environmental conditions, allowing D. radiodurans to modulate protein export based on cellular needs. The extreme radiation and desiccation resistance of D. radiodurans has likely led to specialized adaptations in these interaction interfaces compared to other bacterial species .

How does D. radiodurans TatC structure differ when expressed in heterologous systems versus native conditions?

Expression of D. radiodurans TatC in heterologous systems versus its native environment reveals several important structural and functional differences:

  • Membrane Environment Effects:

    • D. radiodurans' unique membrane composition (enriched in carotenoids and unusual phospholipids) affects TatC folding and stability

    • In E. coli expression systems, TatC adopts slightly altered conformations due to differences in membrane thickness and lateral pressure

    • These conformational changes can affect protein-protein interaction interfaces and substrate recognition

  • Post-translational Modifications:

    • Native D. radiodurans TatC undergoes specific modifications in response to stress conditions

    • These modifications are absent when expressed in heterologous systems

    • Key differences include altered phosphorylation patterns and oxidation states of specific residues

  • Protein Stability Characteristics:

    • Native TatC shows remarkable stability under radiation exposure and desiccation

    • Recombinant TatC expressed in E. coli exhibits lower stability under these conditions

    • Temperature sensitivity profiles differ significantly between native and recombinant forms

  • Oligomeric State Variations:

    • Native TatC exists predominantly in higher-order oligomeric complexes

    • Recombinant TatC tends toward lower-order oligomers and monomeric forms

    • Crosslinking studies reveal different interaction patterns between expression systems

These differences highlight the importance of considering the cellular context when interpreting structural and functional data from recombinant TatC studies. For the most accurate characterization, complementary approaches combining heterologous expression with studies in the native organism provide the most comprehensive understanding .

How should I analyze changes in TatC expression under different stress conditions?

Analysis of TatC expression changes under different stress conditions requires a systematic approach:

  • Experimental Design Considerations:

    • Include multiple time points (early, middle, late response)

    • Test various stress intensities (mild, moderate, severe)

    • Compare different stressors (radiation, desiccation, oxidative stress)

    • Include appropriate controls and biological replicates

  • Quantitative Analysis Methods:

    • RT-qPCR for mRNA expression (normalize with multiple reference genes)

    • Western blotting with densitometry for protein levels

    • Proteomic techniques like SILAC or TMT labeling for global analysis

  • Data Normalization Strategy:

    • For accurate comparisons between conditions, normalize TatC expression to:

      • Total protein content

      • Housekeeping genes/proteins (e.g., 16S rRNA, RecA)

      • Internal standards

  • Statistical Analysis Framework:

    • Apply appropriate statistical tests (ANOVA with post-hoc tests)

    • Consider transformations for non-normally distributed data

    • Calculate fold changes relative to control conditions

    • Determine statistical significance (p < 0.05)

  • Interpretation Guidelines:

    • Correlate TatC expression changes with physiological responses

    • Consider expression patterns of Tat substrates and related proteins

    • Integrate with broader stress response networks (DdrO, IrrE regulons)

    • Compare with existing literature on stress responses in D. radiodurans

The table below provides an example framework for analyzing TatC expression changes:

Stress ConditionTime PointFold Change (mRNA)Fold Change (Protein)Statistical SignificanceRelated Pathway Responses
γ-radiation (5 kGy)30 min1.8 ± 0.21.2 ± 0.1p < 0.01DdrO cleavage, RDR activation
γ-radiation (5 kGy)2 hours2.3 ± 0.31.9 ± 0.2p < 0.001DNA repair enzyme upregulation
Desiccation (48h)Recovery 2h2.5 ± 0.42.1 ± 0.3p < 0.001Membrane remodeling
H₂O₂ (50 mM)1 hour1.6 ± 0.21.4 ± 0.2p < 0.05Catalase upregulation

What approaches can I use to identify the complete set of proteins transported by the TatC pathway in D. radiodurans?

To comprehensively identify the Tat-dependent secretome of D. radiodurans, implement the following multi-faceted approach:

  • Bioinformatic Prediction:

    • Scan the D. radiodurans genome for proteins containing twin-arginine signal peptides

    • Apply multiple prediction algorithms (TatP, PRED-TAT, TatFind)

    • Filter candidates based on consensus predictions

    • Analyze sequence conservation and structural properties

  • Comparative Proteomics:

    • Compare periplasmic/secreted proteomes between:

      • Wild-type D. radiodurans

      • ΔtatC mutant

      • Complemented strains

    • Use both gel-based (2D-DIGE) and gel-free (LC-MS/MS) approaches

    • Quantify proteins using label-free or isotope labeling methods

  • Reporter Fusion Validation:

    • Create fusions between predicted Tat signal peptides and reporter proteins

    • Test translocation in wild-type and ΔtatC backgrounds

    • Quantify translocation efficiency using activity assays or fluorescence

  • In vivo Crosslinking:

    • Employ photo-crosslinkable amino acids at key positions in TatC

    • Identify interaction partners by mass spectrometry

    • Validate transient interactions with substrates during translocation

  • Integration and Validation:

    • Cross-reference results from all approaches

    • Validate key candidates using targeted approaches

    • Classify substrates based on function and stress response association

Example classification of identified Tat substrates in D. radiodurans:

Functional CategoryNumber of ProteinsRepresentative ExamplesStress Response Association
DNA Repair6UvrA, RecQ-like helicaseRadiation, ROS
Cell Wall Biogenesis8Amidases, TranspeptidasesDesiccation, Osmotic stress
Detoxification11Catalase, PeroxidasesOxidative stress
Metal Homeostasis7Copper oxidases, Iron transportersMetal stress, ROS
Nutrient Acquisition9Phosphatases, AmylasesStarvation
Unknown Function13DR_0505, DR_1768Various

This integrated approach provides a comprehensive view of the Tat-dependent secretome and its role in D. radiodurans' stress responses and general physiology.

How do I resolve contradictory findings in TatC translocation efficiency measurements?

When faced with contradictory results in TatC translocation efficiency measurements, employ this systematic troubleshooting approach:

  • Methodological Evaluation:

    • Compare experimental protocols in detail:

      • Strain backgrounds and genotypes

      • Growth conditions and media composition

      • Substrate selection and concentration

      • Detection methods and their sensitivity

    • Identify methodological differences that might explain discrepancies

  • Biological Variables Assessment:

    • Examine cellular factors that influence Tat system function:

      • Growth phase effects (exponential vs. stationary)

      • Stress conditions during experiments

      • Co-expression of other Tat components

      • Metabolic state of the cells

  • Quantitative Analysis Standardization:

    • Implement consistent quantification methods:

      • Use multiple internal controls

      • Establish standard curves

      • Apply normalization to account for expression level variations

      • Calculate translocation efficiency as percentage of total protein

  • Substrate Property Evaluation:

    • Analyze substrate-specific characteristics:

      • Signal peptide variations

      • Folding kinetics and stability

      • Size and charge distribution

      • Potential for aggregation

  • Reconciliation Strategy:

    • Develop explanatory models that accommodate seemingly contradictory data

    • Design critical experiments to test these models

    • Consider complementary approaches to validate findings

    • Report comprehensive data including potential confounding factors

Example reconciliation table for contradictory translocation efficiency findings:

Contradictory FindingPotential ExplanationValidation ExperimentExpected Outcome
Higher translocation in Lab A vs. Lab BGrowth media differences affecting membrane compositionTest translocation in identical defined mediaConvergence of results
Efficiency varies with substrate concentrationSaturation of Tat machinery at high concentrationsTitration experiments with varying substrate amountsNon-linear relationship revealed
Different results between in vivo and in vitro assaysAbsence of regulatory factors in vitroAdd cellular extracts to in vitro systemIn vitro results approach in vivo measurements
Strain-dependent variationExpression level differences of other Tat componentsStandardize Tat component levelsReduced variability between strains

This systematic approach not only resolves contradictions but often leads to deeper insights into the factors influencing Tat system function in D. radiodurans.

What are common challenges in expressing recombinant D. radiodurans TatC and how can they be overcome?

Recombinant expression of D. radiodurans TatC presents several challenges with specific solutions:

  • Toxicity to Host Cells:

    • Challenge: Overexpression of membrane proteins often disrupts host cell membrane integrity

    • Solutions:

      • Use tightly regulated expression systems (e.g., pET with T7 lysozyme co-expression)

      • Lower induction temperature to 16-18°C

      • Reduce inducer concentration (0.1-0.3 mM IPTG)

      • Consider C41/C43 E. coli strains specifically evolved for membrane protein expression

  • Poor Solubility and Inclusion Body Formation:

    • Challenge: TatC tends to aggregate in inclusion bodies

    • Solutions:

      • Fuse with solubility-enhancing tags (MBP, SUMO)

      • Add chemical chaperones to growth media (4% ethanol, 0.5 M sorbitol)

      • Co-express molecular chaperones (GroEL/ES, DnaK/J)

      • Optimize lysis and extraction buffers with multiple detergent screens

  • Low Expression Yields:

    • Challenge: D. radiodurans codon usage differs from E. coli

    • Solutions:

      • Use codon-optimized synthetic gene

      • Supply rare tRNAs using Rosetta or CodonPlus strains

      • Optimize cultivation conditions (rich media, extended expression time)

      • Scale up culture volume to compensate for low per-cell yield

  • Protein Instability:

    • Challenge: Purified TatC is prone to degradation

    • Solutions:

      • Add protease inhibitor cocktails throughout purification

      • Maintain samples at 4°C during all steps

      • Include stabilizing agents (glycerol 10-20%, specific lipids)

      • Minimize freeze-thaw cycles by preparing single-use aliquots

The table below summarizes optimization strategies and their effectiveness:

ProblemOptimization StrategyEffect on YieldEffect on PurityEffect on Activity
ToxicityC41/C43 E. coli strains2-3× increaseNo changePreserved
Toxicity18°C induction1.5-2× increaseSlight improvementImproved
AggregationMBP fusion3-4× increaseImprovedVariable
AggregationChaperone co-expression2× increaseSignificant improvementSignificantly improved
Low yieldCodon optimization3-5× increaseNo changeNo change
InstabilityAddition of cardiolipinSlight increaseNo change2× increase

How can I verify that recombinant TatC retains native conformation and functionality?

Confirming that recombinant TatC maintains its native conformation and functionality requires multiple complementary approaches:

  • Structural Integrity Assessment:

    • Circular Dichroism (CD) Spectroscopy:

      • Compare secondary structure content between native and recombinant TatC

      • Monitor thermal stability profiles

      • Assess conformational changes in different detergent environments

    • Limited Proteolysis:

      • Expose native and recombinant TatC to controlled protease digestion

      • Compare fragmentation patterns by SDS-PAGE

      • Identify protected regions indicating properly folded domains

  • Functional Verification:

    • In vitro Binding Assays:

      • Measure binding of synthetic Tat signal peptides using ITC or fluorescence anisotropy

      • Compare binding affinities between native and recombinant TatC

      • Test binding specificity with mutated signal peptides

    • Reconstitution Experiments:

      • Incorporate recombinant TatC into liposomes

      • Assess interaction with TatA/B components

      • Measure translocation of model substrates across membranes

  • In vivo Complementation:

    • Genetic Rescue:

      • Express recombinant TatC in ΔtatC D. radiodurans strains

      • Measure restoration of stress resistance phenotypes

      • Quantify translocation of known Tat substrates

    • Heterologous System Testing:

      • Express D. radiodurans TatC in E. coli ΔtatC strains

      • Test functionality using E. coli Tat substrates

      • Compare with native E. coli TatC complementation

Functionality verification data example:

Functionality TestParameter MeasuredNative TatCRecombinant TatCInactive Control
Signal peptide bindingK<sub>d</sub> (nM)45 ± 552 ± 8>500
TatA/B interactionCo-purification (%)85 ± 778 ± 9<10
Liposome reconstitutionTranslocation efficiency (%)62 ± 555 ± 7<5
ΔtatC complementationRadiation resistance (% survival)10085 ± 10<5

What are the key considerations for designing TatC mutations to study structure-function relationships?

When designing TatC mutations for structure-function studies, consider these critical factors:

  • Target Site Selection:

    • Conserved Residues:

      • Align TatC sequences across diverse species

      • Identify absolutely conserved residues as primary targets

      • Focus on conservation patterns specific to radiation-resistant organisms

    • Functional Domains:

      • Target the cytoplasmic N-terminal domain (signal peptide binding)

      • Focus on the first cytoplasmic loop (substrate recognition)

      • Consider transmembrane helix interfaces (TatA/B interaction)

      • Examine periplasmic loops (translocation function)

  • Mutation Design Strategy:

    • Substitution Type:

      • Conservative substitutions: preserve physicochemical properties to detect subtle effects

      • Non-conservative substitutions: assess essential nature of specific properties

      • Alanine scanning: systematic replacement with alanine to remove side chain function

      • Cysteine substitutions: enable subsequent chemical modification or crosslinking

    • Multiple Mutations:

      • Design double mutants to test functional interactions

      • Create chimeric constructs with other species' TatC

      • Consider domain swapping to identify functional regions

  • Expression Control:

    • Maintain native expression levels to avoid artifacts

    • Use inducible systems for titration of expression

    • Create genomic point mutations when possible

    • Consider compensatory mutations if stability is compromised

  • Functional Readouts:

    • Select appropriate assays for each mutant category

    • Include both in vivo and in vitro functional tests

    • Measure both binding and translocation activities

    • Assess effects on complex formation with TatA/B

Example mutation design matrix:

DomainResidueConservationSubstitutionPredicted EffectAssay
N-terminalE10UniversalE10ADisrupt signal peptide bindingPeptide binding
N-terminalE10UniversalE10DSubtle effect on bindingPeptide binding
TM1F38D. radiodurans-specificF38AAffect membrane insertionMembrane topology
Cytoplasmic loop 1R92UniversalR92AAbolish substrate recognitionSubstrate interaction
TM4-TM5 interfaceL170ModerateL170CProbe helix-helix interactionsCrosslinking
Periplasmic loopP210LowP210GAlter loop flexibilityTranslocation efficiency

This systematic approach ensures that mutations provide meaningful insights into TatC structure-function relationships while minimizing artifacts and misinterpretations.

What are emerging technologies that could advance D. radiodurans TatC research?

The field of D. radiodurans TatC research stands to benefit from several cutting-edge technologies:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy: Enabling visualization of the entire Tat complex in different functional states

    • Integrative structural modeling: Combining multiple data sources (crosslinking, EPR, SAXS) to model dynamic complexes

    • Single-particle tracking: Following individual Tat complexes during transport events

    • Hydrogen-deuterium exchange mass spectrometry: Mapping conformational changes during substrate binding and transport

  • Genome Engineering Technologies:

    • CRISPR-Cas systems optimized for D. radiodurans: Enabling precise genomic modifications

    • Base editing technologies: Creating specific amino acid substitutions without double-strand breaks

    • Multiplex genome engineering: Simultaneously modifying multiple components of the Tat system

    • Inducible degradation systems: Enabling temporal control of TatC levels

  • High-throughput Functional Analysis:

    • Deep mutational scanning: Comprehensive analysis of thousands of TatC variants

    • Microfluidic single-cell analysis: Correlating Tat activity with cellular phenotypes

    • Automated protein purification and characterization: Enabling parallel analysis of multiple TatC variants

    • Machine learning approaches: Predicting functional impacts of TatC mutations

  • Systems Biology Integration:

    • Multi-omics data integration: Connecting TatC function with global cellular responses

    • Metabolic flux analysis: Understanding energetic requirements of Tat transport

    • Network modeling: Placing the Tat system within D. radiodurans stress response networks

    • Comparative systems analysis: Contrasting Tat function across species with varying stress resistance

These emerging technologies will enable more comprehensive understanding of how the TatC protein functions within the extreme stress resistance mechanisms of D. radiodurans.

How can findings from D. radiodurans TatC research be applied to understanding protein translocation in other extremophiles?

Research on D. radiodurans TatC provides valuable insights applicable to protein translocation in diverse extremophiles:

  • Comparative Genomics Applications:

    • Identify conserved adaptations in Tat systems across extremophiles

    • Distinguish radiation-specific from general extremophile adaptations

    • Trace evolutionary pathways of Tat system specialization

    • Develop predictive models for Tat system properties based on environmental niche

  • Structural Adaptation Principles:

    • Extract general principles of membrane protein stabilization

    • Identify critical residues that confer stress resistance

    • Understand how protein-protein interfaces are preserved under extreme conditions

    • Determine how flexibility and rigidity are balanced in different environments

  • Functional Conservation Assessment:

    • Compare substrate specificities across extremophile Tat systems

    • Identify convergent evolution in substrate recognition mechanisms

    • Determine how translocation efficiency is maintained under stress

    • Understand energy coupling mechanisms in different extremophiles

  • Biotechnological Applications:

    • Design robust protein secretion systems for industrial applications

    • Develop extremophile-based cell factories for enzyme production

    • Create hybrid translocation systems with enhanced stability

    • Engineer stress-resistant properties into mesophilic secretion systems

By systematically comparing D. radiodurans TatC with counterparts from thermophiles, halophiles, acidophiles, and other extremophiles, researchers can extract universal principles of protein translocation under extreme conditions and apply these insights to both fundamental understanding and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.