Recombinant Deinococcus radiodurans Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Protein Overview

YedZ belongs to the sulfoxide reductase family, which participates in redox homeostasis by repairing oxidized methionine residues via methionine sulfoxide reductases (Msr). In D. radiodurans, oxidative stress resistance is critical for surviving ionizing radiation, desiccation, and heavy metal toxicity . While recombinant YedZ from D. radiodurans is not explicitly detailed in the provided sources, homologs in related systems and functional analogs in D. radiodurans suggest its role involves:

  • Heme-binding: Facilitating electron transfer during sulfoxide reduction.

  • Antioxidant activity: Mitigating reactive oxygen species (ROS) via methionine repair .

Key Domains and Features

Based on homologous systems (e.g., E. coli YedZ ):

FeatureDescription
Heme-binding motifConserved residues (e.g., CXXCH) coordinate heme for redox reactions.
Catalytic siteContains conserved cysteine pairs critical for sulfoxide reduction.
Molecular weight~24–27 kDa (predicted for D. radiodurans based on homologs).

In D. radiodurans, a structurally distinct sulfite oxidase lacking heme-binding domains has been identified, suggesting functional diversification in redox enzymes . This contrasts with E. coli YedZ, which retains heme-dependent activity .

Role in Oxidative Stress Resistance

  • MsrA synergy: D. radiodurans employs a small RNA (DsrO) to posttranscriptionally regulate msrA, enhancing methionine sulfoxide reductase activity under oxidative stress . While YedZ is not directly mentioned, its putative role in analogous pathways could involve substrate channeling or electron donation.

  • Radioresistance link: Proteins like RecA and DdrB are central to DNA repair in D. radiodurans . Though YedZ’s direct involvement is unconfirmed, redox enzymes often support genome stability by reducing ROS-induced macromolecular damage .

Experimental Data Gaps

  • No direct studies on recombinant D. radiodurans YedZ were identified in the provided sources.

  • E. coli recombinant YedZ (1-211aa, His-tagged) is commercially available , but its D. radiodurans counterpart remains uncharacterized.

Comparative Analysis with Homologs

OrganismProteinKey FeaturesReference
E. coli O81YedZ (B7MW36)Heme-binding, N-terminal His tag, 211aa
D. radioduransSulfite oxidaseNo heme domain, Mo-cofactor dependent
D. radioduransMsrADsrO-regulated, repairs oxidized methionine

Potential Applications

Recombinant YedZ could be engineered for:

  • Bioremediation: Enhancing oxidative stress tolerance in D. radiodurans strains used for radioactive waste cleanup .

  • Industrial enzymology: Optimizing redox catalysts for synthetic biology under extreme conditions.

Future Directions

  • Structural characterization: Cryo-EM or X-ray crystallography to resolve heme-binding and catalytic sites.

  • Knockout studies: Assessing phenotypic changes in yedZ-deficient D. radiodurans under oxidative stress.

  • Synergy assays: Testing interactions with MsrA, RecA, and DdrB to map redox repair networks.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice is required, please communicate with us beforehand for additional charges.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; DR_2537; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Target Names
msrQ
Target Protein Sequence
MARRPPPYAWLGPGVVLGGLLPTVFLLWDALSGGLGANPVKQATHQTGQLALIVLTLSLA CTPARVWLGWTWAARIRKALGLLAAFYAVLHFGIYLRGQDFSLGRIWEDVTERPFITSGF AALLLLLPLVLTSGKGSVRRLGFARWTLLHRLVYLAAALGALHYWWGVKKDHSGPLLAVL VLAALGLARLKTPARLNRPARQ
Uniprot No.

Target Background

Function
This protein is part of the MsrPQ system, which repairs oxidized cell envelope proteins containing methionine sulfoxide residues (Met-O). The system utilizes respiratory chain electrons. This repair process protects these proteins from oxidative-stress damage caused by reactive oxygen and chlorine species. MsrPQ is crucial for maintaining envelope integrity under bleach stress, rescuing a diverse range of structurally unrelated cell envelope proteins from methionine oxidation. MsrQ supplies electrons for reduction to the reductase catalytic subunit MsrP, using the quinone pool of the respiratory chain.
Database Links

KEGG: dra:DR_2537

STRING: 243230.DR_2537

Protein Families
MsrQ family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Deinococcus radiodurans YedZ protein and what is its biological role?

The YedZ protein from Deinococcus radiodurans is a sulfoxide reductase heme-binding subunit (Q9RRF5) comprising 202 amino acids. It functions as part of the cellular redox machinery in D. radiodurans, an extremophilic bacterium known for its extraordinary radiation resistance . The protein contains a transmembrane domain with several hydrophobic regions that anchor it to the membrane, as evidenced by its amino acid sequence which includes multiple hydrophobic stretches particularly in the N-terminal region .

YedZ is believed to participate in the cell's defense against oxidative stress by catalyzing the reduction of sulfoxides, thereby contributing to the remarkable stress resistance profile of D. radiodurans . The protein's heme-binding capability suggests its involvement in electron transfer reactions typical of reductases. While not as extensively studied as the thioredoxin system in D. radiodurans, YedZ likely complements other redox systems to maintain cellular redox homeostasis under extreme conditions .

How does the D. radiodurans YedZ differ from homologous proteins in other bacteria?

The D. radiodurans YedZ protein shares structural similarities with homologous proteins found in other bacteria, but possesses unique features that likely contribute to its function in an extremophilic organism. Comparative sequence analysis reveals several key differences:

  • The amino acid composition shows adaptation to extremophilic conditions, with increased hydrophobic residues in transmembrane regions for enhanced stability .

  • Unlike many bacterial sulfoxide reductases, the D. radiodurans YedZ appears to have evolved specific features that enable it to function under conditions of extreme oxidative stress that would typically accompany radiation exposure .

  • The protein likely contains structural modifications that prevent denaturation under conditions where DNA damage and repair are actively occurring, as D. radiodurans must maintain protein functionality during recovery from radiation damage .

  • Specific amino acid substitutions at key functional sites may contribute to altered redox potential or substrate specificity compared to non-extremophilic bacterial homologs, though detailed structural comparison studies are still needed in the field .

What expression systems are most effective for producing recombinant D. radiodurans YedZ?

  • Due to the membrane-associated nature of YedZ, expression systems capable of properly integrating membrane proteins are preferable. E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), may yield better results than standard BL21(DE3) strains.

  • The choice of vector should include appropriate fusion tags that facilitate both purification and potentially solubilization. The N-terminal His-tag approach has been successfully implemented for YedZ , but other fusion partners like MBP or SUMO may be considered for improving solubility.

  • Optimization of expression conditions is crucial and should be approached using Design of Experiments (DoE) methodology rather than the one-factor-at-a-time approach. This allows for systematic evaluation of combined effects of temperature, inducer concentration, expression duration, and media composition .

  • For membrane proteins like YedZ, consider lower expression temperatures (16-20°C) and reduced inducer concentrations to prevent inclusion body formation and facilitate proper membrane insertion.

How should researchers design experiments to optimize recombinant YedZ production?

Optimizing recombinant YedZ production requires a systematic approach to experimental design. The Design of Experiments (DoE) methodology is strongly recommended over the traditional one-factor-at-a-time approach, as it can reveal interaction effects between variables that might otherwise be missed .

A comprehensive optimization strategy should include:

  • Selection of critical parameters: Identify factors likely to affect YedZ expression, including:

    • Induction conditions (IPTG concentration, temperature, timing)

    • Media composition (base media, supplements, trace elements)

    • Host strain characteristics

    • Plasmid copy number and promoter strength

    • Co-expression of chaperones or heme biosynthesis genes

  • Implementation of factorial design: Use fractional or full factorial designs to efficiently test combinations of variables. For example, a 2³ factorial design could test three factors at two levels each, requiring only 8 experimental conditions instead of numerous one-at-a-time experiments .

  • Response surface methodology (RSM): After identifying significant factors, employ RSM to determine optimal levels. This approach models the relationship between multiple experimental variables and the target response (YedZ yield and activity) .

  • Validation experiments: Confirm the predicted optimal conditions with validation runs, including appropriate controls and replicates to ensure statistical significance.

  • Scale-up considerations: Evaluate whether optimized conditions at small scale can be effectively transferred to larger production volumes.

What purification strategies are most effective for isolating functional YedZ protein?

Purifying membrane-associated proteins like YedZ presents unique challenges that require specialized approaches:

How can researchers assess the functional activity of purified YedZ protein?

Functional characterization of YedZ requires assays specifically designed to measure sulfoxide reductase activity and heme binding properties:

  • Spectroscopic analysis: UV-visible spectroscopy can confirm proper heme incorporation, with characteristic absorbance peaks at approximately 410 nm (Soret band) and 530-560 nm (α/β bands) indicating correctly folded hemoprotein.

  • Enzyme activity assays: Measure sulfoxide reductase activity using:

    • Dimethyl sulfoxide (DMSO) or methionine sulfoxide as model substrates

    • Monitoring consumption of reducing equivalents (NADPH) in a coupled enzyme system

    • Quantifying substrate conversion using HPLC or mass spectrometry

  • Redox potential determination: Determine the redox potential of YedZ using cyclic voltammetry or spectroelectrochemical methods to understand its position in the cellular electron transfer chain.

  • Binding studies: Characterize substrate binding using:

    • Isothermal titration calorimetry

    • Surface plasmon resonance

    • Fluorescence quenching studies

  • Heme coordination analysis: Assess the coordination state of the heme using resonance Raman spectroscopy or electron paramagnetic resonance (EPR) to understand the catalytic mechanism.

  • Comparative activity analysis: Compare the activity of D. radiodurans YedZ with homologous proteins from non-extremophilic organisms to identify unique functional properties related to extremophilic adaptation .

What are the major challenges in studying membrane-associated proteins like YedZ, and how can they be addressed?

Membrane-associated proteins like YedZ present several significant research challenges:

  • Expression and folding: Membrane proteins often misfold or aggregate when overexpressed.

    • Solution: Implement slower expression rates using lower temperatures (16-20°C) and weaker promoters or auto-induction systems.

    • Solution: Co-express molecular chaperones specific for membrane protein folding (e.g., FtsH, YidC).

  • Detergent compatibility: Finding detergents that extract YedZ while preserving its structure and function is challenging.

    • Solution: Perform systematic detergent screening using a panel of at least 8-10 different detergents at varying concentrations.

    • Solution: Consider using newer amphipathic polymers (e.g., SMALPs, amphipols) that can extract membrane proteins while maintaining the local lipid environment.

  • Heme incorporation: Ensuring proper incorporation of the heme cofactor during recombinant expression.

    • Solution: Supplement growth media with δ-aminolevulinic acid to enhance heme biosynthesis.

    • Solution: Consider co-expression of heme transport or incorporation proteins.

  • Functional assays: Developing reliable activity assays for membrane-bound enzymes.

    • Solution: Design assays compatible with detergent micelles or reconstituted proteoliposomes.

    • Solution: Utilize artificial electron donors/acceptors that can access the active site in the membrane-like environment.

  • Structural characterization: Obtaining structural information remains difficult.

    • Solution: Apply integrative approaches combining cryo-EM, cross-linking mass spectrometry, and computational modeling.

    • Solution: Consider nanodiscs or lipid cubic phase systems for structural studies.

How does the extremophilic nature of D. radiodurans affect YedZ structure and function compared to mesophilic homologs?

The extremophilic origin of D. radiodurans YedZ likely confers unique properties that distinguish it from mesophilic counterparts:

  • Structural stability: YedZ from D. radiodurans may possess enhanced structural stability given the organism's ability to withstand extreme conditions .

    • Investigation approach: Perform comparative thermal and chemical denaturation studies between D. radiodurans YedZ and homologs from mesophilic bacteria.

    • Investigation approach: Analyze amino acid composition for enrichment of stabilizing residues, particularly at protein-membrane interfaces.

  • Redox adaptations: As D. radiodurans survives extreme oxidative stress, YedZ likely has adapted mechanisms to maintain function under these conditions .

    • Investigation approach: Characterize activity under various oxidative stress conditions (H₂O₂, radiation, metal-catalyzed oxidation).

    • Investigation approach: Identify potentially protective amino acid substitutions around the heme binding site.

  • Protein-protein interactions: YedZ may have evolved specific interactions with other components of D. radiodurans stress response systems.

    • Investigation approach: Perform pull-down assays followed by mass spectrometry to identify interaction partners.

    • Investigation approach: Compare interactomes between D. radiodurans YedZ and mesophilic homologs.

  • Substrate specificity: The substrate profile of D. radiodurans YedZ may differ from mesophilic counterparts.

    • Investigation approach: Conduct comparative substrate screening using a library of potential sulfoxide substrates.

    • Investigation approach: Perform comparative molecular docking studies to identify structural determinants of substrate specificity.

  • Metal coordination: The heme environment may have adaptations that provide stability under extreme conditions.

    • Investigation approach: Use spectroscopic techniques (EPR, XAS) to characterize the heme coordination environment.

What approaches can be used to study the role of YedZ in the oxidative stress response of D. radiodurans?

Understanding YedZ's role in D. radiodurans' oxidative stress response requires multi-faceted approaches:

  • Gene knockout/complementation studies:

    • Generate a yedZ deletion strain of D. radiodurans and characterize its phenotype under various stress conditions (radiation, oxidative stress, desiccation).

    • Complement with wild-type or mutant yedZ to establish structure-function relationships.

    • Measure survival rates, growth kinetics, and ROS accumulation in these strains .

  • Global expression analysis:

    • Perform RNA-Seq or proteomics comparing wild-type and ΔyedZ strains under stress conditions to identify affected pathways.

    • Analyze proteins co-regulated with YedZ under stress to identify functional networks.

  • In vivo redox state assessment:

    • Use redox-sensitive fluorescent proteins fused to YedZ to monitor its redox state in living cells during stress.

    • Measure the in vivo oxidation state of potential YedZ substrates in wild-type versus ΔyedZ strains.

  • Integration with other redox systems:

    • Investigate potential functional overlap or cooperation between YedZ and other redox systems like thioredoxin .

    • Generate double mutants (e.g., ΔyedZ/ΔtrxR) to assess synthetic phenotypes that might reveal functional relationships.

  • Physiological substrate identification:

    • Use comparative metabolomics between wild-type and ΔyedZ strains to identify accumulated sulfoxides.

    • Develop activity-based protein profiling probes specific for YedZ to capture substrates in vivo.

How should researchers analyze and interpret kinetic data for YedZ enzymatic activity?

Proper analysis of YedZ enzyme kinetics requires careful consideration of the unique challenges posed by membrane proteins:

  • Model selection and validation:

    • Beyond standard Michaelis-Menten kinetics, consider more complex models that account for potential substrate inhibition or cooperativity.

    • Use statistical methods to determine the best-fitting model (Akaike Information Criterion or F-test comparisons).

    • Validate the selected model using residual analysis and bootstrap resampling.

  • Accounting for detergent effects:

    • Measure kinetic parameters in multiple detergent systems to distinguish true enzymatic properties from detergent artifacts.

    • Consider the impact of detergent concentration on substrate availability and enzyme conformation.

    • If possible, compare kinetics in detergent micelles versus reconstituted proteoliposomes.

  • Data presentation format:

    • Present data in formats that clearly communicate the quality of kinetic measurements:

    ParameterValue95% Confidence IntervalConditions
    Km for substrate XX.X μMX.X-X.X μM25°C, pH 7.4, 0.05% DDM
    kcatX.X s⁻¹X.X-X.X s⁻¹25°C, pH 7.4, 0.05% DDM
    kcat/KmX.X M⁻¹s⁻¹X.X-X.X M⁻¹s⁻¹25°C, pH 7.4, 0.05% DDM
  • Comparative analysis:

    • Systematically compare kinetic parameters across different conditions (pH, temperature, ionic strength) to understand environmental influences on activity.

    • When comparing YedZ to homologs, ensure identical experimental conditions or account for differences in analysis.

  • Integration of kinetic data with structural information:

    • Use site-directed mutagenesis of catalytic residues to establish structure-function relationships.

    • Correlate changes in kinetic parameters with specific structural features to develop mechanistic models.

What statistical approaches should be used when analyzing experimental data related to YedZ protein?

  • Experimental design considerations:

    • Implement Design of Experiments (DoE) approaches to systematically investigate factors affecting YedZ expression, purification, and activity .

    • Determine appropriate sample sizes through power analysis to ensure experiments can detect biologically relevant effects.

    • Include randomization and appropriate controls to minimize systematic errors.

  • Data preprocessing:

    • Check for and address outliers using established statistical methods rather than arbitrary removal.

    • Transform data when necessary to meet assumptions of parametric tests (e.g., log transformation for non-normally distributed enzymatic activity data).

    • Standardize measurements across different experimental batches to enable valid comparisons.

  • Statistical test selection:

    • Choose appropriate statistical tests based on experimental design and data properties:

      • For comparing multiple conditions: ANOVA followed by appropriate post-hoc tests (e.g., Tukey's HSD for all-pairwise comparisons)

      • For examining relationships between variables: Regression analysis or correlation tests

      • For non-parametric data: Kruskal-Wallis, Mann-Whitney U, or other appropriate non-parametric tests

  • Multiple testing correction:

    • When performing multiple comparisons, apply corrections such as Bonferroni, Benjamini-Hochberg, or Holm's sequential correction to control false discovery rates.

    • Report both uncorrected and corrected p-values for transparency.

  • Reporting standards:

    • Report effect sizes alongside statistical significance to communicate biological relevance.

    • Provide clear visualization of data distributions using box plots, violin plots, or scatter plots with error bars representing 95% confidence intervals.

    • Follow field-standard statistical reporting guidelines, including test statistics, degrees of freedom, and exact p-values.

How can researchers effectively troubleshoot expression and purification issues with recombinant YedZ?

Systematic troubleshooting approaches for recombinant YedZ expression and purification challenges include:

  • Expression troubleshooting decision tree:

    • Problem: No detectable expression

      • Check: Vector sequence integrity, reading frame, and promoter function

      • Check: Host strain compatibility with membrane protein expression

      • Try: Alternative host strains designed for membrane proteins (C41/C43)

      • Try: Lower induction temperatures (16°C) and reduced inducer concentrations

    • Problem: Expression but mostly insoluble

      • Try: Fusion partners known to enhance membrane protein solubility (MBP, SUMO)

      • Try: Co-expression with chaperones specific for membrane proteins

      • Try: Alternative membrane-targeting sequences or expression as separate domains

    • Problem: Poor heme incorporation

      • Supplement: Growth media with δ-aminolevulinic acid and iron

      • Consider: Co-expression of heme transport or biosynthesis proteins

      • Optimize: Oxygenation levels during expression

  • Purification troubleshooting matrix:

    ProblemPotential CausesSolutions to Try
    Poor binding to IMACHis-tag inaccessibleTry different tag positions (N vs. C-terminal)
    Inadequate metal loadingRecharge column with fresh metal ions
    Interference from detergentTest detergents compatible with IMAC
    Protein aggregationDetergent concentration too lowMaintain detergent above CMC in all buffers
    Protein instabilityInclude stabilizing additives (glycerol, specific lipids)
    Oxidation of thiol groupsAdd reducing agents compatible with heme (e.g., TCEP)
    Low activity after purificationHeme loss during purificationSupplement buffers with hemin
    Improper foldingTest gentle refolding protocols
    Detergent inhibitionTry milder detergents or nanodiscs
  • Validation approaches:

    • Use multiple analytical techniques to verify protein identity and integrity (mass spectrometry, N-terminal sequencing).

    • Employ size exclusion chromatography to assess oligomeric state and aggregation.

    • Confirm heme incorporation using UV-visible spectroscopy and pyridine hemochrome assay.

    • "Listen to the data" when troubleshooting rather than forcing preconceived ideas .

What are the emerging techniques that could advance our understanding of YedZ structure and function?

Several cutting-edge methodologies hold promise for deepening our understanding of YedZ:

  • Cryo-EM for membrane protein structural determination:

    • Recent advances in cryo-EM now allow structural determination of membrane proteins in native-like environments.

    • Application to YedZ: Determine structure in nanodiscs or other membrane mimetics to understand membrane integration and substrate access channels.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Provides information about protein dynamics and ligand-induced conformational changes.

    • Application to YedZ: Map conformational changes associated with substrate binding and catalysis, particularly relevant for membrane-embedded active sites.

  • Single-molecule techniques:

    • Allow observation of individual enzyme molecules to reveal heterogeneity in function.

    • Application to YedZ: Track conformational changes during catalysis using FRET pairs introduced at strategic positions.

  • AI-based structure prediction:

    • Tools like AlphaFold2 have revolutionized protein structure prediction.

    • Application to YedZ: Generate structural models to guide experimental design, especially for difficult-to-crystallize membrane proteins.

  • In-cell NMR spectroscopy:

    • Allows characterization of proteins in their native cellular environment.

    • Application to YedZ: Monitor structural changes and interactions under physiologically relevant conditions.

  • CRISPR-based screens:

    • Enable genome-wide identification of genetic interactions.

    • Application to YedZ: Identify genes that interact with yedZ to uncover its role in cellular pathways and stress response networks .

How can system-level approaches advance our understanding of YedZ's role in D. radiodurans?

Integrating YedZ research into broader systems biology frameworks can provide deeper insights:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and ΔyedZ strains under various stress conditions.

    • Create comprehensive network models of redox regulation in D. radiodurans to position YedZ within the larger cellular context.

    • Identify previously unrecognized connections between YedZ and other cellular systems.

  • Synthetic biology approaches:

    • Engineer minimal synthetic systems containing YedZ and its interaction partners to define essential functional modules.

    • Transfer the D. radiodurans YedZ system to model organisms to assess its contribution to stress resistance in isolation from other extremophilic adaptations.

  • Computational modeling of redox networks:

    • Develop kinetic models of the D. radiodurans redox network incorporating YedZ activity.

    • Perform in silico perturbation analysis to predict cellular responses to various stressors with and without functional YedZ.

    • Compare model predictions with experimental observations to refine understanding.

  • Evolutionary systems biology:

    • Compare YedZ homologs across extremophiles and mesophiles to identify convergent adaptations.

    • Reconstruct the evolutionary trajectory of YedZ specialization in relation to the development of extremophilic traits in D. radiodurans.

    • Use ancestral sequence reconstruction to experimentally test evolutionary hypotheses about YedZ function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.