Recombinant Deinococcus radiodurans Uncharacterized protein DR_0893 (DR_0893)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
DR_0893; Uncharacterized protein DR_0893
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Target Names
DR_0893
Target Protein Sequence
MVKSMQQIAMTQQKTLDQVRTFMARTYSWMAAGLALTAGVAYLTAQNEGLAMQVASLRLP LMLAQLALVFVLSMFAQRLSAAVAGALFVGYAALTGLTFSALLFAYSPAAVITAFAVSAG TFGLMSVAGFVIKKDLSAMGRFFLFAVLGLVVAMLVNLFVGSSALSLGISMIGVFLFAGL TAYDTQMLRNLALSGISGEQAERASINGALALYLDFINIFLFLLNIGNSRD
Uniprot No.

Target Background

Database Links

KEGG: dra:DR_0893

STRING: 243230.DR_0893

Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What genomic context surrounds the DR_0893 gene in Deinococcus radiodurans?

The DR_0893 gene exists within the complex genome of D. radiodurans, an organism famous for its remarkable resistance to radiation and oxidative stress. When approaching uncharacterized proteins, genomic context analysis provides crucial initial insights.

Methodological approach: Conduct comparative genomic analysis between different D. radiodurans strains (such as BAA-816 and ATCC 13939K) to identify conservation patterns and potential discrepancies in the DR_0893 sequence . This involves:

  • Genome sequence alignment using tools like BLAST

  • Analysis of flanking genes and potential operons

  • Identification of promoter regions and regulatory elements

  • Assessment of conservation across Deinococcus species

Similar to other genes in D. radiodurans, the DR_0893 locus may contain strain-specific variations. For example, as seen with other D. radiodurans genes, frameshift mutations or nucleotide insertions/deletions between strains can significantly alter protein structure and function .

What computational approaches can predict the potential function of DR_0893?

As an uncharacterized protein, DR_0893 requires comprehensive bioinformatic analysis before experimental characterization.

Methodological approach: Apply a multi-faceted computational analysis including:

  • Sequence homology searches against characterized proteins

  • Domain and motif identification using databases like Pfam, PROSITE, and InterPro

  • Secondary structure prediction using algorithms like PSIPRED

  • Tertiary structure modeling using tools like AlphaFold2 or I-TASSER

These methods help identify potential functional elements that guide experimental design. For hypothetical proteins, this approach has proven valuable in discovering new structures and functions, which further allows classification into protein pathways and cascades .

Table 1: Recommended Computational Analysis Pipeline for DR_0893

Analysis TypeToolsExpected OutcomesLimitations
Sequence HomologyBLAST, HHpredPotential homologs, functional cluesLimited by database annotations
Domain PredictionInterPro, PfamConserved domains, functional motifsMay miss novel domains
Structural PredictionAlphaFold2, I-TASSER3D model, potential binding sitesAccuracy depends on similar structures
Subcellular LocalizationPSORT, SignalPCellular compartment, signal peptidesPrediction only
Phylogenetic AnalysisMEGA, PhyMLEvolutionary relationshipsDepends on alignment quality

What expression systems are most suitable for recombinant production of DR_0893?

Producing sufficient quantities of purified DR_0893 is essential for functional and structural studies.

Methodological approach: Consider multiple expression systems based on protein characteristics:

  • E. coli-based expression (BL21, Rosetta strains) as first-line approach

  • Optimization of codon usage for heterologous expression

  • Testing different fusion tags (His, GST, MBP) for improved solubility

  • Exploration of native expression in D. radiodurans itself

When expressing hypothetical proteins, purification challenges often arise due to unknown characteristics. Using peptide mass fingerprinting techniques to verify protein identity is crucial after purification . For proteins from extremophiles like D. radiodurans, consider how the native environment (radiation resistance, oxidative stress protection) might impact protein folding and function.

How can experimental approaches establish the potential role of DR_0893 in radiation resistance?

D. radiodurans' remarkable ability to withstand extreme radiation makes determining the contribution of individual proteins to this phenotype particularly valuable.

Methodological approach: Implement a multi-faceted experimental design:

  • Generate gene knockout mutants using homologous recombination or CRISPR-Cas9

  • Expose wild-type and mutant strains to varying radiation doses

  • Measure survival rates, DNA repair kinetics, and oxidative stress markers

  • Complement mutants with wild-type gene to confirm phenotype

When designing radiation exposure experiments, control for confounding variables such as growth phase, media composition, and temperature . Similar to other radiation response genes in D. radiodurans (like ddrA, ddrB), DR_0893 may participate in DNA repair pathways or protection against oxidative damage .

What protein-protein interaction studies would reveal DR_0893's functional networks?

Understanding the interaction partners of DR_0893 provides crucial insights into its cellular role within D. radiodurans.

Methodological approach: Implement complementary interaction detection methods:

  • Co-immunoprecipitation with antibodies against DR_0893

  • Bacterial two-hybrid assays to screen for interacting partners

  • Pull-down assays using recombinant tagged DR_0893

  • Crosslinking mass spectrometry to capture transient interactions

For quantitative analysis of protein interactions, consider affinity purification coupled with mass spectrometry (AP-MS). This approach has been successful in elucidating protein complexes involved in stress response mechanisms similar to those in D. radiodurans .

Table 2: Comparison of Protein-Protein Interaction Methods for DR_0893 Study

MethodAdvantagesLimitationsData Output
Co-immunoprecipitationDetects native interactionsRequires specific antibodiesQualitative, identifies strong interactions
Bacterial Two-HybridScreens large librariesPotential false positivesBinary interaction data
Pull-down AssaysHighly controlled conditionsMay miss weak interactionsSemi-quantitative binding data
Crosslinking MSCaptures transient interactionsComplex data analysisProximity maps, interaction sites
Protein MicroarraysHigh-throughput screeningExpensive, technically demandingQuantitative interaction networks

How should researchers design experiments to determine if DR_0893 participates in DNA repair mechanisms?

Given D. radiodurans' exceptional DNA repair capabilities, investigating whether DR_0893 participates in these pathways is a priority research question.

Methodological approach: Implement a systematic experimental design:

  • Expose DR_0893 knockout strains to DNA-damaging agents (radiation, H₂O₂, mitomycin C)

  • Measure DNA damage and repair kinetics using comet assays or pulse-field gel electrophoresis

  • Assess co-localization with known DNA repair proteins through fluorescence microscopy

  • Test direct DNA binding capability of purified DR_0893 using electrophoretic mobility shift assays

When designing these experiments, consider how D. radiodurans utilizes synthesis-dependent strand annealing (SDSA) and extended-SDSA (ESDSA) for double-strand break repair . Comparing phenotypes with known DNA repair mutants (RecA, UvrD) provides valuable contextual data.

What mass spectrometry approaches best characterize potential post-translational modifications of DR_0893?

Post-translational modifications (PTMs) often regulate protein function, particularly in stress response proteins.

Methodological approach: Apply complementary mass spectrometry techniques:

  • Bottom-up proteomics with enrichment strategies for specific PTMs (phosphorylation, acetylation)

  • Top-down proteomics to analyze intact protein and modification combinations

  • Targeted parallel reaction monitoring for quantification of specific modifications

  • Comparative analysis between normal and stress conditions

Peptide mass fingerprinting techniques are essential first steps in protein characterization . For stress response proteins in D. radiodurans, phosphorylation and oxidation states may change significantly between normal growth and stress conditions .

How can crystallographic or cryo-EM studies of DR_0893 inform structure-function relationships?

Structural determination provides critical insights into protein function, especially for uncharacterized proteins.

Methodological approach: Address the challenges of structural biology systematically:

  • Optimize protein expression and purification for structural homogeneity

  • Screen multiple crystallization conditions or prepare cryo-EM grids

  • Consider protein engineering (surface entropy reduction, truncation constructs) to improve crystallization

  • Perform structure-guided mutagenesis to validate functional predictions

When designing structural studies, consider how the extreme resistance characteristics of D. radiodurans proteins may affect structural stability . Compare structural features with other characterized radiation response proteins from D. radiodurans (like DdrA, DdrB) to identify functional motifs.

What controls are essential when studying an uncharacterized protein like DR_0893?

Proper experimental controls ensure reliable and interpretable results when investigating novel proteins.

Methodological approach: Implement comprehensive control strategies:

  • Include wild-type strains alongside knockout mutants

  • Create complementation strains to confirm phenotype specificity

  • Use inactive mutants (e.g., catalytic site mutations) as negative controls

  • Include well-characterized proteins with similar predicted functions as comparative controls

Control for extraneous variables that might affect experimental outcomes, including growth conditions, oxidative stress levels, and experimental timing . For D. radiodurans specifically, consider how multi-copy genome status might affect genetic manipulation experiments.

How should researchers address potential contradictions in DR_0893 functional data?

Conflicting data is common when characterizing novel proteins and requires systematic resolution approaches.

Methodological approach: Implement a structured troubleshooting strategy:

  • Verify protein expression and localization under experimental conditions

  • Assess potential strain-specific variations in the DR_0893 sequence

  • Evaluate differences in experimental conditions (media, temperature, stress levels)

  • Consider redundant or compensatory systems that may mask phenotypes

Similar to observations in other D. radiodurans genes, small sequence variations between laboratory strains can significantly impact protein function . Carefully document experimental conditions to facilitate replication and comparison across studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.