Recombinant Delftia acidovorans NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
nuoA; Daci_5180; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Delftia acidovorans (strain DSM 14801 / SPH-1)
Target Names
nuoA
Target Protein Sequence
MNIDQYLPVLLFILVGMGVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVR YYLVAILFILFDLEIAFLLPWAVALRDVGGAGFAAVLIFLTVLVVGFVYEWKKGALDWD
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thereby harnessing redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NqrA in the Na+-translocating NADH-quinone oxidoreductase (Na+-NQR) complex?

NqrA facilitates electron transfer between NADH and ubiquinone while contributing to sodium ion translocation across bacterial membranes. Although early studies suggested direct involvement in ubiquinone binding, structural analyses reveal that NqrA primarily stabilizes the interaction between ubiquinone and the catalytic NqrB subunit . For example, Strickland et al. (2014) demonstrated that mutations in NqrB (e.g., G140A) disrupt conformational changes required for ubiquinone accessibility, indirectly implicating NqrA in maintaining the enzyme’s structural integrity . Methodologically, researchers use site-directed mutagenesis coupled with spectroscopic assays (e.g., UV-Vis and FTIR) to monitor redox state changes in flavin and Fe-S cofactors during electron transport .

How is recombinant NqrA expressed and purified for functional studies?

Recombinant NqrA is typically expressed in Escherichia coli BL21(DE3) strains using pET vectors with N-terminal His-tags for affinity purification. A critical step involves optimizing induction conditions (e.g., 0.5 mM IPTG at 18°C for 16 hours) to minimize inclusion body formation. Post-lysis, immobilized metal affinity chromatography (IMAC) under anaerobic conditions preserves redox-sensitive cofactors. Purity is validated via SDS-PAGE and mass spectrometry, with functional activity confirmed through NADH oxidation assays (monitored at 340 nm) and ubiquinone-binding studies using isothermal titration calorimetry (ITC) .

What experimental approaches resolve contradictions in proposed ubiquinone-binding mechanisms involving NqrA?

Discrepancies arise from conflicting reports about whether NqrA directly binds ubiquinone or merely facilitates its docking. Advanced methodologies include:

  • Photoaffinity labeling: Using photoreactive ubiquinone analogs (e.g., PUQ-3) to map binding pockets in NqrA .

  • Cryo-EM structural analysis: Resolving conformational states of Na+-NQR during ubiquinone reduction at 3.2 Å resolution .

  • Comparative mutagenesis: Introducing point mutations (e.g., NqrA-L32A) and quantifying effects on ubiquinone dissociation constants (Kd) via surface plasmon resonance (SPR) .

For instance, a 2014 study showed that while NqrA binds ubiquinone with low affinity (Kd = 18 ± 3 µM), catalytic activity requires synergistic interactions with NqrB .

How does NqrA contribute to sodium translocation efficiency, and how is this quantified?

NqrA’s role in ion transport is assessed using combined electrophysiological and biochemical assays:

  • Liposome reconstitution: Incorporate purified Na+-NQR into proteoliposomes and measure Na+ flux using 22Na+ radioisotopes or fluorescent dyes (e.g., Sodium Green).

  • Stopped-flow kinetics: Monitor NADH oxidation rates under varying Na+ concentrations to calculate coupling stoichiometry (e.g., 2 Na+/2 electrons) .

  • Voltage-sensitive probes: Detect membrane potential changes in live D. acidovorans cells using DiSC3(5) fluorescence .

Data from these methods reveal that NqrA-deficient mutants exhibit 60–70% reduced Na+ translocation efficiency compared to wild-type enzymes .

What strategies mitigate oxidative damage during NqrA isolation?

NqrA’s Fe-S clusters are prone to oxidative degradation, necessitating:

  • Anaerobic chambers: Maintain O2 levels below 1 ppm during purification.

  • Radical scavengers: Include 2 mM dithiothreitol (DTT) and 5% glycerol in buffers.

  • Rapid freeze-thaw cycles: Preserve activity by flash-freezing purified NqrA in liquid N2 with 10% trehalose .

How are structural dynamics of NqrA characterized during catalytic cycling?

Time-resolved techniques are employed:

  • Stopped-flow FTIR: Captures ubiquinone-induced conformational changes at 1 ms resolution .

  • DEER spectroscopy: Measures distance changes between spin-labeled residues in NqrA during electron transfer .

  • Molecular dynamics simulations: Predicts flexibility of the NqrA loop (residues 131–138) critical for quinone access .

How do researchers validate NqrA’s role in vivo versus in vitro?

In vivo validation:

  • Gene knockout strains: Compare ∆nqrA mutants with wild-type D. acidovorans using growth assays under Na+-limited conditions .

  • Fluorescent reporters: Fuse NqrA to GFP and monitor localization via super-resolution microscopy .

In vitro validation:

  • Reconstitution assays: Measure electron transfer rates in liposomes containing NqrA ± other subunits .

What statistical models resolve conflicting kinetic data for NqrA-associated activities?

Conflicts in reported Km values for NADH (range: 12–45 µM) are addressed via:

  • Global kinetic fitting: Simultaneously analyze data from multiple studies using nonlinear regression in tools like KinTek Explorer .

  • Error source decomposition: Quantify contributions of assay conditions (e.g., temperature, ionic strength) to variability .

Comparative Analysis Table

ParameterNqrA Wild-TypeNqrA-L32A MutantMethod Used
Ubiquinone Kd (µM)18 ± 352 ± 6ITC
Na+ Transport Rate (nmol/min/mg)120 ± 1545 ± 822Na+ flux assay
Thermal Stability (Tm, °C)68.2 ± 0.561.7 ± 1.2DSC

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.