Recombinant Delftia acidovorans UPF0761 membrane protein Daci_4966 (Daci_4966)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics and Origin

Recombinant Delftia acidovorans UPF0761 membrane protein Daci_4966 is derived from the gram-negative bacterium Delftia acidovorans, specifically from the strain DSM 14801 / SPH-1 . This protein belongs to the UPF0761 family of membrane proteins, with UPF (Uncharacterized Protein Family) designation indicating that its precise biological function remains to be fully elucidated. The protein is encoded by the Daci_4966 gene in the bacterial genome and has been assigned the UniProt ID A9BMQ0 .

The full-length protein consists of 417 amino acids, with the complete sequence being well-documented in protein databases and commercial product listings . The amino acid sequence is characterized by multiple hydrophobic segments typical of integral membrane proteins, suggesting a significant membrane-spanning topology. This structure is consistent with its classification as a membrane protein, likely involved in transport or signaling functions across the bacterial cell membrane.

As a membrane protein, Daci_4966 represents an important category of biological molecules that play crucial roles in cellular processes. Membrane proteins generally function in essential processes such as molecular transport, signal transduction, enzymatic activity, and cell-cell interactions, making them valuable subjects for both basic research and potential applications in biotechnology and medicine .

Expression Systems and Methods

The recombinant form of Delftia acidovorans UPF0761 membrane protein Daci_4966 is typically produced using Escherichia coli as the expression host . This bacterial expression system offers several advantages for producing recombinant membrane proteins, including rapid growth, high protein yields, and well-established genetic manipulation techniques.

The production process typically involves the following steps:

  1. Cloning of the Daci_4966 gene into an appropriate expression vector

  2. Transformation of the expression vector into competent E. coli cells

  3. Induction of protein expression under controlled conditions

  4. Cell harvesting and lysis

  5. Protein purification, typically using affinity chromatography

  6. Quality control measures, including purity assessment by SDS-PAGE

To facilitate purification, the recombinant protein is often produced with an affinity tag, most commonly a polyhistidine (His) tag fused to either the N-terminus or C-terminus of the protein . The His-tag enables efficient purification using immobilized metal affinity chromatography (IMAC), a standard technique for isolating recombinant proteins with high purity.

Reconstitution Protocol

The recommended reconstitution protocol for the lyophilized protein includes the following steps:

  1. Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (with 50% being the manufacturer's default recommendation)

  4. Prepare small aliquots to minimize repeated freeze-thaw cycles

It is specifically noted that repeated freezing and thawing should be avoided as these processes can lead to protein denaturation and loss of functionality . This recommendation is particularly important for membrane proteins, which often exhibit greater sensitivity to structural disruption compared to soluble proteins.

General Applications of Membrane Proteins

Membrane proteins like Delftia acidovorans UPF0761 membrane protein Daci_4966 are valuable research tools with diverse applications in scientific inquiry and biotechnology. While specific research utilizing this particular protein is limited in the available literature, recombinant membrane proteins generally serve important functions in several key areas:

  1. Structural biology: Membrane proteins are studied to understand their three-dimensional structures and structure-function relationships . High-resolution structural information can be obtained using techniques such as X-ray crystallography, cryo-electron microscopy, and nuclear magnetic resonance spectroscopy, though these approaches often require significant quantities of pure, stable protein.

  2. Drug development: Recombinant membrane proteins are essential tools for studying drug-target interactions, binding mechanisms, and evaluating drug activity and specificity . Many pharmaceutical compounds target membrane proteins, making them crucial for both basic research and applied drug discovery.

  3. Functional characterization: Expression of recombinant membrane proteins enables detailed investigation of their biological functions, including transport activities, signaling capabilities, and enzymatic properties. These studies contribute to our understanding of both normal cellular processes and disease mechanisms.

Potential Research Applications for Daci_4966

While the specific functions and research applications of Daci_4966 are not extensively documented in the available literature, its classification as a membrane protein suggests several potential areas of investigation:

  1. Bacterial physiology: As a membrane protein from Delftia acidovorans, Daci_4966 may play roles in essential cellular processes such as nutrient transport, environmental sensing, or maintaining membrane integrity. Studies of this protein could contribute to our understanding of bacterial adaptation and survival mechanisms.

  2. Antimicrobial research: Bacterial membrane proteins can serve as targets for antimicrobial compounds. Characterization of Daci_4966 could potentially identify novel targets for antibacterial agents, particularly relevant given the increasing problem of antimicrobial resistance.

  3. Biotechnology applications: Understanding the structure and function of bacterial membrane proteins can lead to applications in biotechnology, such as the development of biosensors, biocatalysts, or protein engineering platforms.

  4. Comparative proteomics: Analysis of Daci_4966 in comparison with homologous proteins from other bacterial species could provide insights into evolutionary relationships and functional conservation among bacterial membrane proteins.

AlphaFold Structure Prediction

The three-dimensional structure of Delftia acidovorans UPF0761 membrane protein Daci_4966 has been computationally predicted using AlphaFold, a cutting-edge deep learning system for protein structure prediction. The predicted structure is available in the RCSB Protein Data Bank with the identifier AF_AFA9BMQ0F1 .

Important characteristics of this computational model include:

  1. Release date: The model was initially released in AlphaFold DB on December 9, 2021, and last modified on September 30, 2022 .

  2. Confidence metrics: The global pLDDT (predicted Local Distance Difference Test) score for the model is 76.21, placing it in the "Confident" category (70 < pLDDT ≤ 90) . This score indicates a relatively reliable prediction for most regions of the protein, though not at the highest confidence level.

  3. Confidence categories in the AlphaFold prediction system:

    • Very high (pLDDT > 90)

    • Confident (70 < pLDDT ≤ 90)

    • Low (50 < pLDDT ≤ 70)

    • Very low (pLDDT ≤ 50)

It is important to note that this is a computational model and not an experimentally determined structure. The RCSB PDB entry specifically states: "There are no experimental data to verify the accuracy of this computed structure model." While computational models provide valuable insights, they should be interpreted with appropriate caution until validated by experimental methods.

Future Research Directions

The recombinant Delftia acidovorans UPF0761 membrane protein Daci_4966 represents an area with significant potential for further investigation. Several promising research directions could advance our understanding of this protein:

  1. Functional characterization: Determining the specific biological function of this membrane protein through biochemical and biophysical assays would address a fundamental knowledge gap. Potential approaches include transport assays, binding studies with potential ligands, and assessment of enzymatic activities.

  2. Experimental structure determination: While computational models provide valuable insights, experimental determination of the protein's structure using techniques such as X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy would yield more definitive structural information. Such data would validate or refine the current computational model.

  3. Interaction studies: Identifying protein-protein or protein-ligand interactions involving Daci_4966 could provide insights into its functional networks and biological roles. Techniques such as co-immunoprecipitation, pull-down assays, or surface plasmon resonance could be employed for this purpose.

  4. Genetic studies: Investigation of the effects of gene knockout or overexpression of Daci_4966 in Delftia acidovorans could reveal its physiological importance and potential roles in bacterial survival, growth, or environmental adaptation.

  5. Comparative analysis: Analysis of homologous proteins across different bacterial species could provide evolutionary insights and potentially inform functional predictions based on conservation patterns and taxonomic distribution.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Daci_4966; UPF0761 membrane protein Daci_4966
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-417
Protein Length
full length protein
Species
Delftia acidovorans (strain DSM 14801 / SPH-1)
Target Names
Daci_4966
Target Protein Sequence
MERPEPVVPPSWRERLRCFPWRNTAHTLRERFREDRLGVTASSLTFTTVLALVPFFTVAL ALFTAFPIFSRVQIVLERWLIDSLIPETIARQVLGYLTQFASKASQLGMAGFSILVITAV ALILTIDRTLNNIWRVRQLRPLGQRVLIYWAAITLGPLVLGLSLVLSSYVMSASRGLVNA LPEGLRFIFDSIEYLALAAGMAGLYHYVPNTAVRWRHAWVGGLFVATCMELAKKALGLYL ASVPTYSVIYGTFATLPILLIWIYMAWIIVLLGAVVTAYLPIVMAGVQRMPGQQGWQFEM AVEILQYLEQERESPAKGLYASDLARRLHVDWQQIDPVLQALSVLDWVGTVQAPGVAAGS EGTEPRYMLLVDPQHTPLAPLVERLLLAPSAAVQPLWERTGLAGMTLASLLESRPRP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Delftia acidovorans UPF0761 membrane protein Daci_4966?

Daci_4966 is a membrane protein encoded by the Delftia acidovorans genome (strain DSM 14801 / SPH-1) with UniProt accession number A9BMQ0. It belongs to the UPF0761 protein family and consists of 417 amino acids forming a complete membrane-spanning structure. The protein is characterized by multiple transmembrane domains that anchor it within the bacterial cell membrane . Delftia acidovorans is primarily an environmental organism rarely associated with clinical significance, though it has been documented in some rare infections .

How does Daci_4966 compare to other membrane proteins in Delftia acidovorans?

While Daci_4966 is characterized as a UPF0761 family membrane protein, Delftia acidovorans also expresses other significant membrane proteins, most notably Omp32, which is the major outer membrane protein of the bacterium. Unlike Daci_4966, Omp32 has been extensively characterized structurally and functionally as an anion-selective porin with a 16-stranded beta-barrel structure. Omp32 demonstrates specific substrate binding capabilities, particularly for malate, which reflects the physiological adaptation of the organism to organic acids . Comparative analysis between these membrane proteins can provide insights into the diverse functional roles of membrane proteins within the same organism.

What are the optimal storage conditions for recombinant Daci_4966?

Recombinant Daci_4966 should be stored under the following conditions for maximum stability and activity:

Storage PurposeRecommended TemperatureBuffer CompositionDuration
Long-term storage-20°C to -80°CTris-based buffer with 50% glycerolMonths to years
Working aliquots4°CTris-based buffer with 50% glycerolUp to one week

It's important to note that repeated freezing and thawing cycles should be avoided as they can significantly degrade protein quality. Instead, prepare small working aliquots for routine experiments . For applications requiring extended stability, storage at -80°C is preferable over -20°C.

How can I measure the diffusion rate of Daci_4966 in membrane systems?

The lateral diffusion rates of membrane proteins like Daci_4966 can be measured using fluorescence-based techniques:

  • Fluorescence Recovery After Photobleaching (FRAP): This method involves:

    • Marking Daci_4966 with a specific fluorescent group (either using a fluorescent ligand like an antibody or expressing the protein fused to GFP)

    • Bleaching the fluorescent group in a small area using a laser beam

    • Measuring the time taken for adjacent unbleached protein molecules to diffuse into the bleached area

    • Calculating the diffusion coefficient from the recovery curve

  • Fluorescence Loss in Photobleaching (FLIP): This complementary technique involves:

    • Continuously irradiating a small area with a laser beam

    • Monitoring the gradual depletion of fluorescently labeled molecules from surrounding membrane areas

    • Analyzing the rate of fluorescence loss to determine diffusion properties

These techniques can provide valuable information about Daci_4966's mobility within the membrane and potential interactions with other membrane components .

What expression systems are recommended for producing recombinant Daci_4966?

  • Prokaryotic systems (E. coli):

    • Advantages: High yield, cost-effective, rapid growth

    • Limitations: Potential issues with proper folding of complex membrane proteins

    • Recommended strains: C41(DE3) or C43(DE3) that are engineered for membrane protein expression

  • Eukaryotic systems:

    • Insect cells (Sf9, Hi5): Better for complex membrane proteins requiring post-translational modifications

    • Yeast (Pichia pastoris): Combines high yields with eukaryotic processing capabilities

  • Cell-free systems:

    • Useful for toxic membrane proteins

    • Allows direct incorporation into nanodiscs or liposomes

The optimal expression system should be determined through small-scale trials comparing protein yield, folding quality, and functional activity.

What techniques are most effective for determining the structure of Daci_4966?

For structural determination of membrane proteins like Daci_4966, multiple complementary approaches should be considered:

  • X-ray Crystallography: Requires:

    • Purification in detergent micelles or lipidic cubic phase

    • Screening of numerous crystallization conditions

    • This approach was successful for the related Omp32 protein from Delftia acidovorans, yielding high-resolution structures (1.5 Å and 1.45 Å)

  • Cryo-Electron Microscopy (Cryo-EM):

    • Increasingly popular for membrane proteins

    • May not require crystallization

    • Can capture multiple conformational states

    • Particularly useful if Daci_4966 forms larger complexes

  • NMR Spectroscopy:

    • Suitable for smaller membrane proteins or specific domains

    • Can provide dynamics information not available from static structures

    • Typically requires isotopic labeling (15N, 13C)

  • Computational Approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to study conformational changes

    • Similar to the 7-ns unbiased molecular dynamics simulation performed for Omp32

The choice of method should be guided by the specific research questions and available resources.

How can I predict the membrane topology of Daci_4966?

Predicting the membrane topology of Daci_4966 requires a multi-faceted approach:

  • Computational prediction tools:

    • TMHMM, HMMTOP, or TOPCONS for transmembrane helix prediction

    • PROFtmb for beta-barrel prediction

    • SignalP for signal peptide identification

  • Experimental validation:

    • Cysteine scanning mutagenesis with accessibility assays

    • Protease protection assays to identify exposed regions

    • Reporter fusion constructs (e.g., PhoA or GFP) to determine orientation

  • Combined approach:

    • Start with computational predictions

    • Verify key topological features experimentally

    • Refine models based on experimental data

This systematic approach helps establish a reliable topology model that can guide further structural and functional studies of Daci_4966.

What are the predicted functional roles of Daci_4966 based on sequence analysis?

While specific functions of Daci_4966 have not been definitively established in the available literature, sequence analysis and comparison with related proteins suggest potential roles:

  • Membrane transport: The multi-transmembrane domain structure is characteristic of proteins involved in small molecule transport across membranes.

  • Signaling function: Some UPF (Uncharacterized Protein Family) members participate in signal transduction across membranes.

  • Structural role: It may contribute to membrane integrity or organization within Delftia acidovorans.

  • Stress response: Environmental bacteria often utilize membrane proteins as part of adaptation mechanisms to changing conditions.

To confirm these predicted functions, targeted experimental approaches would be required, including gene knockout studies, substrate transport assays, and protein-protein interaction analyses.

How can I investigate potential ligand interactions with Daci_4966?

To investigate ligand interactions with Daci_4966, consider these methodological approaches:

  • Binding assays:

    • Isothermal Titration Calorimetry (ITC) to measure binding thermodynamics

    • Surface Plasmon Resonance (SPR) for real-time binding kinetics

    • Microscale Thermophoresis (MST) for interactions in solution

  • Structural approaches:

    • Co-crystallization with potential ligands (similar to the approach used for Omp32 with malate)

    • NMR chemical shift perturbation experiments

    • Cryo-EM with bound ligands

  • Functional assays:

    • Electrophysiology measurements in planar lipid bilayers (as used for Omp32)

    • Substrate transport assays using proteoliposomes

    • Fluorescence-based flux assays with reconstituted protein

  • Computational methods:

    • Molecular docking to predict binding sites

    • Molecular dynamics simulations to assess ligand recognition and binding stability

A comprehensive investigation would typically combine multiple approaches to build a complete picture of ligand interactions.

How can Daci_4966 be incorporated into membrane model systems for functional studies?

Incorporating Daci_4966 into membrane model systems is critical for functional characterization. Several approaches are available:

  • Proteoliposomes:

    • Purified Daci_4966 can be reconstituted into liposomes of defined lipid composition

    • Method: Detergent-mediated reconstitution followed by detergent removal via dialysis or bio-beads

    • Applications: Transport assays, ligand binding studies, structural analysis

  • Planar lipid bilayers:

    • Creates accessible membranes for electrical measurements

    • Method: Painting or folding techniques to form bilayers, followed by protein incorporation

    • Applications: Electrophysiology to measure channel or transport properties (similar to conductance measurements performed with Omp32)

  • Nanodiscs:

    • Disc-shaped lipid bilayers stabilized by membrane scaffold proteins

    • Method: Co-assembly of purified Daci_4966, lipids, and scaffold proteins

    • Applications: Structural studies, binding assays, single-molecule measurements

  • Cell-based systems:

    • Expression in model cell lines lacking endogenous transport systems

    • Method: Transfection or viral transduction of Daci_4966 expression constructs

    • Applications: Functional assays in cellular context, localization studies

The choice of system depends on the specific research questions and experimental techniques to be employed.

What insights can molecular dynamics simulations provide about Daci_4966 function?

Molecular dynamics (MD) simulations can provide valuable insights into Daci_4966 function that may be difficult to obtain experimentally:

  • Structural dynamics:

    • Conformational flexibility and transitions between states

    • Local motions of functional importance

    • Similar to the 7-ns unbiased MD simulation performed for Omp32

  • Interaction with lipid environment:

    • Specific lipid-protein interactions

    • Hydrophobic matching with the membrane

    • Influence of membrane composition on protein behavior

  • Substrate transport mechanisms:

    • Pathways for substrate entry and exit

    • Energy barriers along transport pathways

    • Key residues involved in substrate recognition and translocation

    • Similar to how MD trajectories showed malate ion capture and translocation for Omp32

  • Water and ion permeation:

    • Formation of water wires through the protein

    • Ion selectivity mechanisms

    • Gating dynamics

To perform meaningful MD simulations of Daci_4966, the protein should be embedded in a lipid bilayer with appropriate composition, solvated, and simulated for adequate timescales (typically microseconds) to observe relevant functional events.

What strategies can address poor expression or folding of recombinant Daci_4966?

Membrane proteins like Daci_4966 often present challenges in expression and folding. Here are systematic approaches to address common issues:

  • Poor expression yield:

    • Optimize codon usage for the expression host

    • Test different promoter strengths

    • Vary induction conditions (temperature, inducer concentration, timing)

    • Consider specialized expression strains designed for membrane proteins

    • Try fusion tags that enhance expression (e.g., MBP, SUMO)

  • Misfolding and aggregation:

    • Reduce expression rate (lower temperature, weaker promoter)

    • Co-express with chaperones

    • Use mild detergents for extraction and purification

    • Include stabilizing additives (specific lipids, ligands)

  • Protein degradation:

    • Add protease inhibitors during purification

    • Consider the ER-associated degradation pathway's role in quality control of membrane proteins

    • Use protease-deficient expression strains

  • Purification challenges:

    • Screen multiple detergents for extraction efficiency

    • Optimize detergent:protein ratios

    • Consider native nanodiscs or SMALPs for extraction

    • Test different chromatography approaches

Systematic optimization using small-scale expression tests can help identify the most effective conditions before scaling up.

How can I assess the proper folding and functionality of purified Daci_4966?

Verifying proper folding and functionality of purified Daci_4966 is essential before proceeding with detailed studies:

A well-folded membrane protein typically demonstrates characteristic secondary structure content, monodisperse behavior in solution, and functional activity when reconstituted into membrane systems.

How does the membrane environment influence Daci_4966 structure and function?

The lipid environment can significantly impact membrane protein behavior through various mechanisms:

  • Hydrophobic matching:

    • The hydrophobic thickness of the lipid bilayer must match the hydrophobic region of Daci_4966

    • Mismatch can lead to protein tilting, distortion, or aggregation

  • Specific lipid interactions:

    • Certain lipids may bind to specific sites on Daci_4966

    • These interactions can stabilize particular conformations

    • They may be essential for function, similar to how membrane proteins adapt to their environment

  • Membrane fluidity effects:

    • Lateral diffusion rates of Daci_4966 are influenced by membrane fluidity

    • Different lipid compositions alter protein dynamics and potentially function

    • Techniques like FRAP can measure these effects

  • Experimental approaches:

    • Systematic testing of different lipid compositions in reconstitution experiments

    • Native mass spectrometry to identify bound lipids

    • Molecular dynamics simulations to observe lipid-protein interactions

Understanding these interactions is crucial for accurately characterizing Daci_4966's native behavior and for optimizing experimental conditions.

What is the role of Daci_4966 in the context of bacterial physiology?

While specific information about Daci_4966's physiological role is limited in the available literature, we can make informed hypotheses based on knowledge of bacterial membrane proteins and Delftia acidovorans biology:

  • Environmental adaptation:

    • Delftia acidovorans is known to inhabit diverse environments, from soil to clinical settings

    • Membrane proteins often play key roles in adapting to changing conditions

    • Daci_4966 may facilitate survival in specific niches

  • Metabolic functions:

    • Related membrane proteins in Delftia acidovorans (e.g., Omp32) show specificity for organic acids

    • Daci_4966 might participate in nutrient acquisition or metabolite export

  • Experimental approaches to determine physiological role:

    • Gene knockout or knockdown studies with phenotypic analysis

    • Expression profiling under different growth conditions

    • Protein-protein interaction studies to identify functional partners

    • Metabolomic analysis of wildtype vs. Daci_4966-deficient strains

  • Comparative genomics:

    • Identification of Daci_4966 homologs in related species

    • Correlation of protein presence with specific metabolic capabilities

    • Evolutionary analysis to trace functional adaptation

These investigations would provide valuable context for understanding Daci_4966's contribution to Delftia acidovorans biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.