Recombinant Delphinapterus leucas Vitamin K-dependent gamma-carboxylase (GGCX)

Shipped with Ice Packs
In Stock

Description

Substrate Binding and Catalytic Mechanism

  • Propeptide Recognition: GGCX binds VKDP propeptides via hydrophobic and hydrogen-bond interactions. Mutagenesis studies highlight Tyr425 and Leu394 as critical for binding affinity .

  • Processivity: GGCX remains bound to substrates during multiple carboxylation events. Mutations like V255M disrupt processivity, leading to partial carboxylation and impaired clotting activity .

  • Vitamin K Interaction: Reduced vitamin K (VKH₂) acts as a cofactor, with its epoxidation coupled to carboxylation. Structural models suggest a conserved binding pocket near the active site .

Mutation Effects

  • Pathogenic Mutations: Variants like L573F alter substrate specificity, reducing carboxylation efficiency for coagulation factors (e.g., FIX) but sparing bone-related proteins (e.g., osteocalcin) .

  • C-Terminal Truncation: Truncation at R704 abolishes osteocalcin carboxylation but preserves coagulation factor activity, indicating domain-specific substrate recognition .

Comparative Analysis with Orthologs

SpeciesExpression SystemKey Differences
Human (P38435)Insect cellsLower thermostability; requires co-expression with VKOR for optimal activity
Rat (O88496)E. coli95% sequence identity; used for cross-species functional studies
Cone Snail (Conus textile)COS cellsRetains carboxylase activity but requires mammalian systems for proper folding

Applications in Research and Biotechnology

  • Coagulation Studies: Used to carboxylate recombinant clotting factors (e.g., FIX, prothrombin) in E. coli or HEK293 systems .

  • Drug Development: Screens for vitamin K antagonists (e.g., warfarin) and modulators of vascular calcification .

  • Structural Biology: Cryo-EM studies reveal dynamic interactions between GGCX, VKDPs, and vitamin K .

Challenges in Recombinant Production

  • Cofactor Dependency: Requires co-expression with vitamin K epoxide reductase (VKOR) to regenerate VKH₂ .

  • Misfolding in Prokaryotes: Despite high yields in E. coli, mammalian systems are preferred for functional studies due to post-translational modifications .

Future Directions

  • Gene Therapy: Engineered GGCX variants could treat coagulation disorders linked to carboxylase deficiencies .

  • Enzyme Engineering: Directed evolution to enhance substrate specificity for industrial-scale VKDP production .

This synthesis integrates data from expression systems, structural analyses, and clinical studies to provide a comprehensive overview of recombinant Delphinapterus leucas GGCX, underscoring its importance in biochemistry and medicine.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage condition, buffer composition, storage temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
GGCX; Vitamin K-dependent gamma-carboxylase; Gamma-glutamyl carboxylase; Peptidyl-glutamate 4-carboxylase; Vitamin K gamma glutamyl carboxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-758
Protein Length
Full Length of Mature Protein
Species
Delphinapterus leucas (Beluga whale)
Target Names
Target Protein Sequence
AVSARSARSPPDSDKVQKDKAGQTSGRRQGSRMGKLLGFEWTDVSSWGKLVTLLNRPTDP ASLAVFRFLFGLMMVLDIPQERGLSSLDRRYLDGLEVCRFPLLDALQPLPLDWMYLVYTI MFLGALGMMLGLRYRISCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANRYWS VDGLLSARKRNAHVPLWNYAVLRGQIFIVYFIAGVKKLDADWVEGYSMEYLSRHWLFSPF KFVLSEEMTSLLVVHWCGLLLDLSAGFLLFFDASRSIGLLFVSYFHCMNSQLFSIGMFPY VMLASSPLFCSPEWPRKLVAHCPKRLQELLPLRTAPQPSASCVYKRSRAKGGQKPGLRHR LGAAFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTG ELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRI FDPRVDIVQATWSPFQRTPWLQPLLMDLSPWRTKLQEIKSSLDNHTEVVFIADFPGLHLE NFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLQEGEKMQLPAGEYHKVYTMSPSPSCYMY IYVNTTELALEQDLAYLQELKEKVENGSETEPLPPELQPLLEGEVKGGPEPTPLVQTFLR RQQRLQEIERRRNAPFHERLLRFLLRKLYVFRRSFLMTCISLRNLVLGRPSLEQLAQEVT YANLRPFEPVGEPSPSNTDSSNPNPSEPNADAVHSEF
Uniprot No.

Target Background

Function
This protein mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues, accompanied by the conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide.
Protein Families
Vitamin K-dependent gamma-carboxylase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Vitamin K-dependent gamma-carboxylase and what is its primary function?

Vitamin K-dependent (VKD) gamma-glutamyl carboxylase is an enzyme that catalyzes the conversion of specific glutamic acid residues (Glu) to gamma-carboxyglutamic acid residues (Gla) in various proteins. This post-translational modification requires vitamin K hydroquinone as a cofactor and is essential for the biological activity of these proteins. The carboxylation process enables calcium binding, which is crucial for the function of coagulation factors and other VKD proteins . Interestingly, the enzyme also undergoes self-carboxylation, with studies showing approximately 3 mol Gla/mol carboxylase in purified recombinant human carboxylase .

What are the optimal expression systems for recombinant GGCX production?

Several expression systems have proven effective for recombinant GGCX production, with selection depending on research objectives:

  • Insect Cell Systems: Baculovirus-infected insect cells have successfully expressed functional carboxylase, as demonstrated in carboxylase carboxylation studies . This system is particularly valuable for post-translational modifications.

  • Mammalian Cell Lines: BHK (Baby Hamster Kidney) cells have been used to culture recombinant carboxylase for in vivo studies of vitamin K-dependent carboxylation . COS cells have also demonstrated success in expressing vitamin K-dependent carboxylase activity .

When selecting an expression system, researchers should consider:

  • The need for post-translational modifications

  • Required protein yield

  • Experimental timeline

  • Downstream applications (structural studies, enzymatic assays, etc.)

A comparative study of expression systems should be conducted during protocol optimization to determine which provides the best combination of yield, activity, and stability for your specific experimental needs.

What are the recommended storage conditions for preserving GGCX activity?

To maintain optimal activity of recombinant Delphinapterus leucas GGCX:

  • Store primary stock at -20°C for regular use or -80°C for extended storage

  • Prepare working aliquots to be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they may compromise protein integrity

  • Use a Tris-based buffer with 50% glycerol, optimized for the specific protein

Activity assays should be performed periodically to confirm enzyme stability throughout storage. While specific data on Delphinapterus leucas GGCX stability is limited, general principles of protein storage apply, with particular attention to avoiding oxidation of critical cysteine residues that may be involved in the carboxylation mechanism.

How can researchers reliably measure GGCX enzymatic activity in vitro?

Several methodologies can be employed to measure GGCX activity:

  • Radiometric Assay: Incubate purified recombinant carboxylase with 14CO2 followed by SDS/PAGE analysis to visualize radiolabeled bands. This method allows for direct quantification of carboxylation by detecting incorporated radioactive carbon .

  • HPLC Analysis: Base hydrolysis followed by HPLC can be used to quantify Gla residues formed during the reaction. This technique enables precise determination of the Gla:Glu ratio and calculation of carboxylation efficiency .

  • Substrate-Specific Assays: Using synthetic peptides like Phe-Leu-Glu-Glu-Leu or longer peptides based on known VKD protein sequences. Comparative Km values can provide insights into substrate preference and enzyme kinetics .

When reporting GGCX activity, include:

  • Substrate concentration

  • Vitamin K concentration (typically with Km values of approximately 52 μM)

  • Reaction conditions (temperature, pH, buffer composition)

  • Incubation time

  • Detection method sensitivity and limits

What is the substrate specificity profile of Delphinapterus leucas GGCX compared to other species?

While direct comparative data for Delphinapterus leucas GGCX substrate specificity is limited in the provided literature, insights can be drawn from studies of other carboxylases. The recombinant Conus carboxylase, for example, carboxylates various substrates with different affinities:

SubstrateKm ValueSpecies Origin
Phe-Leu-Glu-Glu-Leu420 μMSynthetic
Human proprothrombin peptide (-18 to +10)1.7 μMHuman
ProFactor IX peptide (-18 to +10)6 μMHuman
Conotoxin ε-TxIX565 μMConus
Conotoxin with 12aa propeptide75 μMConus
Conotoxin with 29aa propeptide74 μMConus

These variations in Km values demonstrate that propeptide regions significantly influence substrate recognition and binding affinity . Researchers working with Delphinapterus leucas GGCX should conduct comparative substrate specificity studies to determine if marine mammal carboxylases have evolved unique substrate preferences that might reflect adaptations to their physiological environment.

How can gene expression analysis be optimized when studying GGCX in different tissues?

When conducting gene expression studies of GGCX across different tissues or under various experimental conditions, selecting appropriate reference genes for normalization is critical. Different tissues and physiological states may require different housekeeping genes to ensure reliable quantification:

  • Selection of Reference Genes: Use multiple algorithms (geNorm, NormFinder, BestKeeper, and RefFinder) to identify the most stable housekeeping genes for your specific experimental context .

  • Tissue-Specific Considerations: Different reference genes may be optimal for different tissues. For example, studies have shown that EF-1α can be the most stable internal control gene in adult tissue samples, with RP13 and RL28 as secondary choices .

  • Multi-Reference Normalization: Rather than relying on a single housekeeping gene, consider using a combination of 2-3 validated reference genes for more robust normalization.

A preliminary validation study to identify stable reference genes is recommended before conducting extensive expression analyses of GGCX. This step is particularly important when comparing expression across different developmental stages, tissues, or experimental conditions.

What are the implications of GGCX self-carboxylation for experimental design?

The discovery that GGCX undergoes self-carboxylation has significant implications for research design:

  • Functional Significance: Self-carboxylation may play a role in enzyme stability and factor IX turnover, suggesting a potential autoregulatory mechanism . Research designs should consider how experimental conditions might affect this self-modification.

  • Quantification Challenges: When measuring GGCX activity, researchers must account for both substrate carboxylation and self-carboxylation. In radioactive assays, verification that the radiolabeled band corresponds to the carboxylase's molecular weight is essential .

  • Vitamin K Dependence: Self-carboxylation is vitamin K-dependent and does not occur in its absence. Experimental designs must include appropriate vitamin K controls to differentiate between enzymatic activities .

  • In Vivo Verification: To confirm physiological relevance, carboxylase purified from cells cultured with and without vitamin K should be analyzed for Gla residues. Previous studies detected approximately 3 mol Gla/mol carboxylase in samples from vitamin K-supplemented cells .

This self-modification property may influence enzyme kinetics, stability, and interaction with substrates, requiring careful consideration in experimental design and data interpretation.

What evolutionary insights can be gained from studying marine mammal GGCX compared to other vertebrates?

Studying GGCX from marine mammals like Delphinapterus leucas provides valuable evolutionary insights:

  • Adaptation to Marine Environment: Marine mammals may have evolved specific adaptations in coagulation pathways due to their diving physiology and unique environmental pressures. Comparing GGCX structure and function across species can reveal adaptations to these specialized physiological demands.

  • Conservation Across Species: The significant homology observed between diverse species (such as the 41% identity between Conus and bovine carboxylases) suggests fundamental conservation of carboxylase function throughout evolution . Identifying highly conserved regions in Delphinapterus leucas GGCX may reveal essential catalytic or structural domains.

  • Propeptide Recognition Mechanisms: Studies of Conus carboxylase revealed that it responds differently to vertebrate and Conus propeptides, suggesting the existence of multiple propeptide-binding sites that evolved differently across lineages . Investigating whether Delphinapterus leucas GGCX shows similar differentiation could provide insights into the evolution of substrate recognition.

Research comparing marine mammal GGCX with terrestrial mammals and other vertebrates may uncover unique adaptations related to deep-diving physiology, including potential modifications to enhance coagulation under high-pressure environments.

How do unique features of marine mammal physiology influence GGCX function?

Marine mammals like Delphinapterus leucas experience physiological challenges including deep diving, prolonged hypoxia, and exposure to cold temperatures, which may influence GGCX function:

  • Pressure Adaptation: Deep-diving marine mammals experience significant pressure changes that could affect enzyme kinetics. Research questions might include whether Delphinapterus leucas GGCX maintains optimal activity under varying pressure conditions compared to terrestrial mammal carboxylases.

  • Temperature Stability: Arctic species like beluga whales experience cold temperatures that could influence enzyme activity. Comparative thermal stability studies between Delphinapterus leucas GGCX and carboxylases from non-arctic species might reveal adaptations to function efficiently at lower temperatures.

  • Oxygen Dependency: Given that marine mammals routinely experience hypoxic conditions during dives, their coagulation pathways may be adapted to function efficiently under variable oxygen levels. Investigating the oxygen dependency of GGCX activity could reveal specialized adaptations.

Experimental approaches might include comparative activity assays under different temperature, pressure, and oxygen conditions, potentially revealing unique structural or functional adaptations in Delphinapterus leucas GGCX related to their marine lifestyle.

What are common challenges in expressing and purifying functional GGCX and how can they be addressed?

Researchers often encounter several challenges when working with GGCX:

  • Low Expression Yields:

    • Problem: GGCX is a membrane-associated protein, which can result in poor expression.

    • Solution: Optimize codon usage for the expression system, consider using fusion tags to enhance solubility, and evaluate different cell lines. Baculovirus-infected insect cells have proven effective for carboxylase expression .

  • Maintaining Enzymatic Activity:

    • Problem: Loss of activity during purification.

    • Solution: Include vitamin K in culture media as studies have shown that carboxylation of the carboxylase only occurs in cells cultured with vitamin K . Use mild detergents for solubilization and consider incorporating stabilizing agents in purification buffers.

  • Protein Aggregation:

    • Problem: GGCX may aggregate during concentration or storage.

    • Solution: Store in Tris-based buffer with 50% glycerol as recommended , avoid repeated freeze-thaw cycles, and use working aliquots at 4°C for short-term experiments.

  • Verification of Functionality:

    • Problem: Confirming that the purified enzyme is properly folded and active.

    • Solution: Perform activity assays with well-characterized substrates such as Phe-Leu-Glu-Glu-Leu or peptides derived from known VKD proteins . Verify self-carboxylation capability as an indicator of proper folding and function .

How should researchers interpret contradictory data when comparing GGCX from different species?

When encountering contradictory results across species:

  • Methodological Differences Assessment:

    • Evaluate differences in expression systems (insect cells vs. mammalian cells)

    • Compare purification protocols and their impact on enzyme activity

    • Consider differences in assay conditions (buffer composition, pH, temperature)

  • Evolutionary Context Analysis:

    • Structural differences may reflect evolutionary adaptations to specific ecological niches

    • Sequence alignments can identify conserved domains versus variable regions

    • Consider that observed differences might be functionally significant adaptations rather than methodological artifacts

  • Substrate Specificity Variations:

    • Different species' carboxylases may have evolved distinct propeptide recognition preferences

    • For example, Conus carboxylase responds differently to vertebrate versus Conus propeptides

    • These differences may reflect the evolutionary divergence of substrate recognition mechanisms

  • Statistical Validation Approaches:

    • Perform multiple independent experiments with biological replicates

    • Use appropriate statistical tests to determine if observed differences are significant

    • Consider meta-analysis approaches when integrating data from multiple studies

When publishing seemingly contradictory findings, clearly describe methodological details and discuss potential biological or technical explanations for observed differences, as these may reveal important insights about the evolution and adaptation of GGCX across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.