Recombinant Crepis alpina Delta (12) fatty acid dehydrogenase

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Crepis alpina Delta (12) fatty acid dehydrogenase (EC 1.14.99.33), also termed crepenynate synthase or Delta-12 fatty acid acetylenase, is a variant FAD2 desaturase engineered for heterologous expression. This enzyme catalyzes the conversion of linoleic acid (18:2Δ9c,12c) into crepenynic acid (18:2Δ9c,12a) by introducing a triple bond at the Δ12 position . Its recombinant form enables scalable production for industrial and research applications, particularly in lipid metabolism studies and bioengineering of specialized fatty acids .

Protein Architecture

The enzyme is a 375-amino-acid polypeptide (UniProt ID: O81931) with a molecular weight of ~43 kDa. Key structural features include:

  • Membrane-binding domains: Critical for substrate interaction and catalytic activity .

  • Catalytic motifs: Four residues (Y150, F259, H266, V304) identified as essential for chemoselectivity and stereoselectivity .

PropertyDetail
Gene SourceCrepis alpina (Hawksbeard)
Expression HostEscherichia coli
TagN-terminal His-tag (varies by construct)
Purity>85% (SDS-PAGE)
Storage-20°C to -80°C in Tris/PBS buffer with 6% trehalose or 50% glycerol

Mutational Analysis

Site-directed mutagenesis reveals functional impacts:

  • F259L: Converts acetylenase to a bifunctional desaturase producing cis and trans isomers .

  • V304I: Restricts activity to stereoselective Δ12 desaturation (cis isomers only) .

  • Y150F: Abolishes acetylenase activity while retaining Δ12 desaturase function .

Reaction Mechanism

The enzyme operates via a diiron-oxo cluster, typical of FAD2 desaturases, but diverges by excising two hydrogens to form a triple bond instead of a double bond . Key substrates and products include:

SubstrateProductReaction Type
Linoleic acid (18:2Δ9c,12c)Crepenynic acid (18:2Δ9c,12a)Δ12 Acetylenation
Oleic acid (18:1Δ9c)No activitySubstrate specificity

Kinetic Parameters

  • Optimal pH: 8.0 (Tris/PBS buffer) .

  • Cofactors: Requires molecular oxygen and ferredoxin; inhibited by cytochrome b5 competitors .

Lipid Biosynthesis

Recombinant expression in Saccharomyces cerevisiae and plant systems enables:

  • Production of crepenynic acid for antimicrobial and pharmaceutical applications .

  • Engineering of conjugated fatty acids (e.g., calendic acid) via co-expression with elongases .

Industrial Relevance

  • Biofuels: Modifies lipid profiles to enhance energy density .

  • Functional Oils: Generates nutraceuticals with anti-inflammatory properties .

Tissue-Specific Expression

  • Seed-specific activity: High transcript levels in developing seeds correlate with crepenynate accumulation (>80% of seed oil) .

  • Non-seed tissues: Despite moderate transcription in flowers, no crepenynate is detected due to competing FAD3 and FAD2-3 desaturases .

Evolutionary Divergence

Phylogenetic analysis places this enzyme within a clade of FAD2-like acetylenases, distinct from canonical desaturases . Structural homology with Mortierella alpina Δ12 desaturases (40–50% identity) underscores functional conservation .

Challenges and Future Directions

  • Instability: Recombinant protein requires stringent storage (-80°C) to prevent aggregation .

  • Substrate channeling: Engineering chimeric enzymes with tailored acyl-CoA specificity could enhance industrial utility .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Delta(12 fatty acid dehydrogenase; Crepenynate synthase; Delta-12 fatty acid acetylenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-375
Protein Length
full length protein
Species
Crepis alpina
Target Names
N/A
Target Protein Sequence
MGGGGRGRTSQKPLMERVSVDPPFTVSDLKQAIPPHCFKRSVIRSSYYIVHDAIIAYIFY FLADKYIPILPAPLAYLAWPLYWFCQASILTGLWVIGHECGHHAFSDYQWVDDTVGFILH SFLMTPYFSWKYSHRNHHANTNSLDNDEVYIPKSKAKVALYYKVLNHPPGRLLIMFITFT LGFPLYLFTNISGKKYERFANHFDPMSPIFKERERFQVLLSDLGLLAVLYGVKLAVAAKG AAWVTCIYGIPVLGVFIFFDIITYLHHTHLSLPHYDSSEWNWLRGALSTIDRDFGFLNSV LHDVTHTHVMHHLFSYIPHYHAKEARDAINTVLGDFYKIDRTPILKAMWREAKECIFIEP EKGRGSKGVYWYNKF
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of the delta-12 double bond of linoleic acid into a triple bond during the biosynthesis of crepenynic acid.
Database Links

KEGG: ag:CAA76158

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Seed.

Q&A

What is Crepis alpina Delta (12) fatty acid dehydrogenase and how does it relate to fatty acid acetylenase?

Crepis alpina Delta (12) fatty acid dehydrogenase is functionally the same enzyme as Crepis alpina acetylenase, a specialized variant of the FAD2 (Fatty Acid Desaturase 2) family. This enzyme catalyzes the insertion of a triple bond (acetylenic bond) at the Delta12 position of linoleic acid to form crepenynic acid ((9Z)-octadeca-9-en-12-ynoic acid) in developing seeds . The term "dehydrogenase" refers to its ability to remove hydrogen atoms from the substrate, while "acetylenase" specifically indicates its function in creating a carbon-carbon triple bond. Biochemically, this enzyme represents a fascinating example of how the FAD2 enzyme scaffold has evolved to catalyze reactions beyond standard desaturation, highlighting the plasticity of fatty acid-modifying enzymes in plants.

What is the primary function of Crepis alpina Delta (12) fatty acid dehydrogenase in plants?

The primary function of this enzyme is the biosynthesis of crepenynic acid through the conversion of linoleic acid by introducing a triple bond at the Delta12 position. In C. alpina, this specialized fatty acid accumulates predominantly in developing seeds, where it likely serves as both a storage compound and potentially as a chemical defense mechanism . The enzyme exhibits a dual functionality, acting as both a conventional desaturase (converting oleic acid to linoleic acid) and as an acetylenase (converting linoleic acid to crepenynic acid) . This multifunctional capability demonstrates the metabolic versatility that has evolved in some plant species to produce specialized fatty acids with unique chemical properties.

How does Crepis alpina Delta (12) fatty acid dehydrogenase differ from standard FAD2 enzymes?

While standard FAD2 enzymes introduce a second double bond at the Delta12 position of oleic acid to form linoleic acid, the C. alpina acetylenase has evolved additional functionality. Research has revealed several key differences:

  • Reaction specificity: The enzyme can perform both conventional desaturation (oleic to linoleic acid) and acetylenation (linoleic to crepenynic acid) .

  • Substrate preference: It exhibits specificity toward the 9(Z),12(Z)-octadecadienoate isomer for acetylenation, not accepting the 9(Z),12(E) isomer as a substrate for triple bond formation .

  • Reaction mechanism: The acetylenation reaction proceeds through distinct steps with significantly different kinetic isotope effects for C12-H and C13-H bond cleavage (k(H)/k(D) = 14.6 ± 3.0 versus 1.25 ± 0.08, respectively) .

  • Co-expression requirements: Unlike standard FAD2s, the acetylenase activity is regulated by co-expression with specific isoforms of other fatty acid desaturases, demonstrating metabolic integration with the fatty acid synthesis pathway .

What is crepenynic acid and why is it significant in plant biochemistry?

Crepenynic acid ((9Z)-octadeca-9-en-12-ynoic acid) is an unusual fatty acid containing both an unsaturated double bond at the Delta9 position and a triple bond at the Delta12 position. Its significance in plant biochemistry includes:

  • Precursor role: In some plant species, crepenynic acid serves as a precursor for polyacetylenic compounds, which function as defense molecules against pathogens and herbivores.

  • Taxonomic marker: The ability to produce crepenynic acid is distributed among specific plant families and can serve as a chemotaxonomic marker.

  • Model for divergent evolution: The acetylenase enzyme responsible for its synthesis represents an excellent model for studying how enzymes evolve new functions from existing scaffolds .

  • Tissue-specific accumulation: In C. alpina, crepenynic acid accumulates specifically in seeds despite transcription of the acetylenase gene in other tissues, presenting a model system for studying post-transcriptional regulation of specialized fatty acid biosynthesis .

What expression systems have been successfully used for recombinant production of Crepis alpina Delta (12) fatty acid dehydrogenase?

Successful expression systems for recombinant production of C. alpina acetylenase include:

  • Saccharomyces cerevisiae: The yeast expression system has been extensively used for functional characterization of the enzyme. Specific plasmids like pJK272 have been developed to produce C. alpina Delta12 fatty acid acetylenase (vFAD2) in yeast . This system is advantageous for studying enzymatic activity since yeast lacks endogenous desaturases that might compete with the recombinant enzyme.

  • Arabidopsis thaliana: Transgenic expression in A. thaliana has been employed to study acetylenase activity in a plant system. This approach allows for evaluation of enzyme function in a more native cellular environment with appropriate cofactors and membrane systems .

The choice between these systems depends on research objectives:

Expression SystemAdvantagesLimitationsBest For
S. cerevisiaeSimple cultivation, minimal competing activities, well-defined lipid compositionLess natural membrane environment than plantsKinetic studies, mechanism analysis
A. thalianaNative plant cellular environment, presence of natural cofactorsEndogenous competing activities may complicate analysisIn vivo functional studies, tissue-specific expression

How can activity of recombinant Crepis alpina Delta (12) fatty acid dehydrogenase be assayed in heterologous expression systems?

Activity assays for recombinant C. alpina acetylenase typically involve:

  • Fatty acid profile analysis: The most direct approach involves analyzing the fatty acid profile of the expression system (yeast or plants) using gas chromatography (GC) or liquid chromatography-mass spectrometry (LC-MS). The appearance of crepenynic acid indicates functional enzyme activity .

  • Substrate feeding studies: Providing the expression system with exogenous substrate (typically linoleic acid) and measuring conversion to crepenynic acid can provide quantitative activity data.

  • Kinetic isotope effect measurements: For detailed mechanistic studies, regiospecifically deuterated linoleic acid substrates can be used with LC-MS analysis to determine isotope effects and reaction mechanisms .

  • Time-course studies: Monitoring the accumulation of reaction products over time allows determination of initial reaction rates and kinetic parameters.

For optimal results, researchers should consider using internal standards for quantification and appropriate controls (such as expression of known FAD2 enzymes) to validate the assay system.

What methods are effective for measuring kinetic parameters of Crepis alpina Delta (12) fatty acid dehydrogenase?

Effective methods for measuring kinetic parameters include:

  • Competitive substrate assays: By incubating a mixture of deuterated and non-deuterated substrates with the enzyme, researchers can determine relative rates through LC-MS analysis of products. This approach has been successfully used to establish kinetic isotope effects (KIEs) for the C. alpina acetylenase .

  • In vivo kinetic measurements: Time-course studies in recombinant systems with varying substrate concentrations can establish apparent Km and Vmax values, though these reflect the composite of substrate availability, enzyme activity, and product incorporation.

  • Temperature and pH dependence: Determining activity across a range of conditions helps establish optimal parameters and provides insights into the enzyme's structural stability and catalytic mechanism.

  • Electron donor studies: Since acetylenases require electron donation systems (cytochrome b5), measuring activity with different electron donors can elucidate cofactor requirements and potential rate-limiting steps .

It's worth noting that full kinetic characterization of membrane-bound enzymes presents significant challenges, as the local substrate concentration in membranes is difficult to precisely control and measure.

How can isotope labeling be used to study the mechanism of Crepis alpina Delta (12) fatty acid dehydrogenase?

Isotope labeling has proven essential for elucidating the C. alpina acetylenase mechanism:

  • Regiospecific deuteration: By specifically labeling the C12 and C13 positions of linoleic acid with deuterium, researchers determined that the oxidation of linoleate proceeds in two discrete steps. The C12-H bond cleavage is highly sensitive to isotopic substitution (k(H)/k(D) = 14.6 ± 3.0), while the C13-H bond breaking shows a minimal isotope effect (k(H)/k(D) = 1.25 ± 0.08) .

  • Stereochemistry studies: Experiments using stereospecifically deuterated oleates revealed that pro-R hydrogen atoms are removed from C12 and C13 during the introduction of the 12(Z) double bond, whereas both pro-R and pro-S hydrogen atoms are removed during formation of the 12(E) double bond .

  • Reaction intermediate tracing: Isotope labeling can potentially identify and track reaction intermediates, providing insights into the complete reaction pathway.

  • Mechanistic comparison: Comparative isotope effect studies between acetylenation and epoxidation reactions have helped establish relationships between these enzymatic mechanisms .

These approaches have collectively established that crepenynic acid production likely proceeds via initial H-atom abstraction at C12 of the linoleoyl substrate, followed by further oxidation to form the triple bond.

What is the tissue-specific expression pattern of Crepis alpina Delta (12) fatty acid dehydrogenase?

The tissue-specific expression pattern of C. alpina acetylenase has been characterized using RT-PCR analysis:

  • Developing seeds: Highest expression levels are observed in developing seeds, consistent with the accumulation of crepenynic acid in this tissue .

  • Flower heads: Moderate expression levels are detected in flower heads, representing the second highest site of acetylenase transcription .

  • Other tissues: Low but detectable expression occurs in various vegetative tissues, despite the absence of crepenynic acid accumulation in these tissues .

Quantitative analysis using real-time RT-PCR revealed a 10,000-fold higher acetylenase expression in developing seeds compared to flower heads, highlighting the dramatic tissue-specific regulation of this gene .

This expression pattern presents an interesting case where transcription alone doesn't predict functional outcomes, as acetylenase transcripts are present in tissues that don't accumulate the enzyme's product.

How does the expression level of Crepis alpina Delta (12) fatty acid dehydrogenase vary during seed development?

The expression of C. alpina acetylenase during seed development follows a specific temporal pattern:

  • Early development: Expression begins during early seed development, coinciding with the onset of oil accumulation.

  • Mid-development: Expression reaches maximum levels during the active oil synthesis phase of seed development.

  • Late development/maturation: Expression typically decreases as seeds approach maturity and oil synthesis slows.

Research demonstrates that the acetylenase is co-expressed with FAD2 isoform 2 (FAD2-2) at high levels in developing seeds, suggesting coordinated regulation of these enzymes during seed oil biosynthesis . This co-expression pattern is critical for understanding how the metabolic pathway for crepenynic acid biosynthesis is regulated developmentally.

What factors regulate the transcription of Crepis alpina Delta (12) fatty acid dehydrogenase?

Several factors have been identified that influence the transcription of C. alpina acetylenase:

  • Developmental signals: Seed development triggers high-level expression, suggesting control by developmental regulators specific to seed maturation programs .

  • Tissue-specific factors: The dramatically higher expression in seeds versus other tissues indicates tissue-specific transcriptional regulation, likely involving seed-specific transcription factors .

  • Coordinated regulation: The co-expression with FAD2-2 suggests shared regulatory elements or transcription factors controlling both genes .

Research in other plants with large FAD2 gene families, such as Artemisia sphaerocephala (which has twenty-six FAD2 members), provides insights into how different FAD2 genes may be regulated by environmental stresses and developmental cues . Similar regulatory mechanisms may apply to C. alpina acetylenase, though specific transcriptional regulators remain to be identified.

Why is functional expression of Crepis alpina Delta (12) fatty acid dehydrogenase limited to seeds despite transcript presence in other tissues?

The discrepancy between acetylenase transcription and functional expression across tissues can be attributed to several factors:

  • Co-expression requirements: Developing seeds co-express acetylenase and FAD2 isoform 2 (FAD2-2) at high levels, while flower heads co-express FAD2-3 and FAD3 at high levels with only moderate levels of FAD2-2 and acetylenase . This differential expression pattern of collaborating enzymes affects functional outcomes.

  • Competition for substrate: In flower heads, high FAD3 expression may compete for the linoleic acid substrate that would otherwise be available for acetylenation .

  • Quantitative differences: Real-time RT-PCR revealed 10,000-fold higher acetylenase expression in seeds than in flower heads, suggesting a threshold level may be required for significant product accumulation .

  • Post-transcriptional regulation: Potential differences in mRNA stability, translation efficiency, or post-translational modifications between tissues could affect enzyme production and activity.

These findings highlight that functional expression of acetylenase appears to be affected by both the absolute expression level and competition/collaboration with other enzymes in the fatty acid modification pathway .

What is the catalytic mechanism of the acetylenation reaction by Crepis alpina Delta (12) fatty acid dehydrogenase?

The catalytic mechanism of the acetylenation reaction has been elucidated through kinetic isotope effect (KIE) studies:

  • Substrate binding: The enzyme binds the linoleic acid substrate with the 9(Z),12(Z) configuration in the active site.

  • Initial hydrogen abstraction: The first step involves abstraction of the hydrogen atom at C12, which is highly sensitive to isotopic substitution (k(H)/k(D) = 14.6 ± 3.0), suggesting this is the rate-limiting step .

  • Second hydrogen removal: The hydrogen at C13 is removed with minimal isotope effect (k(H)/k(D) = 1.25 ± 0.08), indicating this step proceeds rapidly after the initial abstraction .

  • Triple bond formation: Following the removal of both hydrogens, the carbon-carbon triple bond forms to create crepenynic acid.

This two-step process is distinct from typical desaturation reactions and suggests a unique catalytic mechanism. The data support a model where crepenynic acid is produced via initial H-atom abstraction at C12 of the linoleoyl substrate, followed by subsequent oxidation steps to form the acetylenic bond .

What cofactors are required for Crepis alpina Delta (12) fatty acid dehydrogenase activity?

As a membrane-bound non-heme iron enzyme, C. alpina acetylenase requires several cofactors for activity:

  • Iron: The active site contains iron atoms essential for the catalytic mechanism.

  • Oxygen: Molecular oxygen is required as the terminal electron acceptor.

  • Cytochrome b5: Serves as an electron donor, transferring electrons from NADH to the acetylenase. RT-PCR analysis has indicated that the availability of a preferred cytochrome b5 isoform is not a limiting factor for acetylenase activity in different tissues .

  • NADH/NADH-cytochrome b5 reductase: Provides electrons to cytochrome b5, completing the electron transport chain.

How do substrate specificity and stereochemistry affect the function of Crepis alpina Delta (12) fatty acid dehydrogenase?

Substrate specificity and stereochemistry critically influence the function of C. alpina acetylenase:

  • Dual substrate activity: The enzyme can use both oleic acid and linoleic acid as substrates, desaturating oleate with approximately equal efficiency as standard FAD2 enzymes .

  • Geometric isomer specificity: When desaturating oleate, the enzyme produces both 9(Z),12(E)- and 9(Z),12(Z)-octadecadienoates in a ratio of approximately 3:1 .

  • Stereospecific hydrogen removal: During 12(Z) double bond formation, the pro-R hydrogen atoms are removed from C12 and C13, whereas both pro-R and pro-S hydrogen atoms are removed during 12(E) double bond formation .

  • Conformation-dependent catalysis: The enzyme can accommodate oleate having either cisoid or transoid conformation of the C12-C13 single bond, with these conformers serving as precursors for 12(Z) and 12(E) double bonds, respectively .

  • Strict substrate requirements for acetylenation: Only the 9(Z),12(Z)-octadecadienoate isomer can be further desaturated to crepenynic acid; the 9(Z),12(E) isomer is not accepted for triple bond formation .

These findings demonstrate how subtle differences in substrate conformation and enzyme-substrate interactions determine reaction outcomes and product specificity.

What are the key amino acid residues responsible for the acetylenation versus desaturation activity?

While the search results do not provide specific information about key amino acid residues in C. alpina acetylenase, research on FAD2 enzymes more broadly suggests several important residues:

  • Histidine boxes: Three conserved histidine-rich motifs typically coordinate the di-iron center in FAD2 enzymes and are likely essential for both desaturation and acetylenation activities.

  • Substrate channel residues: Amino acids lining the substrate-binding pocket influence the positioning of fatty acid substrates and likely determine whether desaturation or acetylenation occurs.

  • Second-shell residues: Amino acids that don't directly contact the substrate or metal centers but influence the architecture of the active site can significantly impact reaction specificity.

Comparative analysis of acetylenases, epoxygenases, and standard desaturases suggests that relatively few amino acid substitutions may be sufficient to alter reaction outcome, highlighting the evolutionary plasticity of the FAD2 enzyme scaffold . Further research using site-directed mutagenesis would be required to definitively identify the specific residues responsible for acetylenation activity in C. alpina.

How does Crepis alpina Delta (12) fatty acid dehydrogenase compare to similar enzymes in other species like Helianthus annuus?

Comparative analysis reveals important similarities and differences between C. alpina acetylenase and similar enzymes in other species:

  • Functional comparison with Helianthus annuus: While both C. alpina and H. annuus (sunflower) possess Delta12 acetylenases, their metabolic roles differ significantly. H. annuus contains a Delta12 acetylenase in a polyacetylene biosynthetic pathway and does not accumulate crepenynic acid as an end product . Real-time RT-PCR analysis showed relatively strong acetylenase expression in young sunflowers .

  • Expression patterns: C. alpina acetylenase shows highest expression in developing seeds, while the H. annuus enzyme expression is detected in young tissues but does not result in crepenynic acid accumulation .

  • Evolutionary relationships: Phylogenetic analysis of the FAD2 family places acetylenases from different plant species in distinct groups. For example, in Artemisia sphaerocephala, AsFAD2-23 clusters with fatty acid acetylenases and hydroxylases from other plants, suggesting specific evolutionary relationships .

  • Substrate utilization: Both enzymes can use linoleic acid as a substrate, but the fate of reaction products differs due to the presence of downstream enzymes in respective metabolic pathways.

These comparative insights highlight how similar enzymes have been recruited for different metabolic functions across plant species, demonstrating divergent evolution of the FAD2 enzyme family.

What evolutionary relationships exist among plant acetylenases, epoxygenases, and desaturases?

Evolutionary analysis of plant fatty acid-modifying enzymes reveals fascinating relationships:

  • Common ancestry: Acetylenases, epoxygenases, and desaturases all evolved from a common FAD2 ancestor through gene duplication and functional divergence .

  • Functional clustering: Phylogenetic analysis shows that enzymes with similar functions often cluster together regardless of plant species, suggesting convergent evolution of function .

  • Related but distinct mechanisms: The closely related Crepis palaestina Delta12 epoxygenase has only weak desaturase activity but can also produce 9(Z),12(E)-octadecadienoate from oleate, suggesting mechanistic similarities with the C. alpina acetylenase .

  • Evolutionary plasticity: The FAD2 enzyme scaffold has proven remarkably adaptable, evolving to catalyze diverse reactions including desaturation, hydroxylation, acetylenation, and epoxidation through relatively minor sequence changes .

This evolutionary plasticity explains how plants have developed diverse fatty acid modification capabilities using variations on a common enzymatic theme, allowing for the production of specialized fatty acids with various ecological and physiological functions.

Why do some plants accumulate crepenynic acid while others use acetylenases in polyacetylene biosynthetic pathways?

The differential accumulation of crepenynic acid versus its utilization in polyacetylene biosynthesis reflects distinct evolutionary adaptations:

  • Metabolic pathway integration: In C. alpina, crepenynic acid accumulates as an end product in seeds, whereas in H. annuus (sunflower), the acetylenase functions as part of a longer biosynthetic pathway leading to polyacetylenes .

  • Ecological functions: Plants that accumulate crepenynic acid may benefit from its direct defensive properties, while those producing polyacetylenes may require more complex defense compounds with different biological activities.

  • Enzymatic differences: Despite both being classified as acetylenases, subtle differences in enzyme properties or cellular localization may influence whether crepenynic acid accumulates or is further metabolized.

  • Co-evolution of pathways: The presence or absence of downstream enzymes that can utilize crepenynic acid determines whether it accumulates or serves as an intermediate. This represents co-evolution of entire metabolic pathways rather than individual enzymes .

This differential fate of crepenynic acid highlights how similar enzymatic capabilities can be integrated into distinct metabolic pathways to serve various ecological and physiological roles across plant species.

How do the different isoforms of FAD2 in Crepis alpina contribute to their specific metabolic roles?

C. alpina possesses multiple FAD2 isoforms with distinct expression patterns and functions:

  • Tissue-specific roles: Developing seeds co-express acetylenase and FAD2-2 at high levels, while flower heads co-express FAD2-3 and FAD3 at high levels, with only moderate expression of FAD2-2 and acetylenase .

  • Substrate competition and channeling: In flower heads, high expression of FAD3 may compete for the linoleic acid substrate that would otherwise be available for acetylenation by the acetylenase .

  • Developmental regulation: FAD2-3 was not expressed in developing seeds, indicating tissue-specific transcriptional control of different isoforms .

  • Metabolic partitioning: The differential expression of FAD2 isoforms likely contributes to the partitioning of fatty acid flux toward different end products in various tissues.

This complex regulatory pattern of multiple FAD2 isoforms demonstrates how plants utilize gene duplication and functional specialization to achieve tissue-specific metabolic outcomes. The coordinated expression of different FAD2 variants, along with other fatty acid-modifying enzymes, creates a metabolic network that directs fatty acid flux toward specific end products in different tissues .

How can recombinant Crepis alpina Delta (12) fatty acid dehydrogenase be used for biotechnological applications?

Recombinant C. alpina acetylenase offers several biotechnological applications:

  • Production of unusual fatty acids: Expression of the enzyme in heterologous systems like yeast or oilseed crops can generate crepenynic acid for research or potential industrial applications .

  • Metabolic engineering platform: The enzyme serves as a valuable tool for metabolic engineering of novel fatty acid biosynthetic pathways in plants or microorganisms.

  • Structure-function studies: As a model for divergent evolution of enzyme function, the acetylenase provides insights into how to engineer new catalytic activities in existing enzyme scaffolds.

  • Biosynthetic pathway reconstruction: Co-expression with other fatty acid modifying enzymes allows for reconstruction and study of complete biosynthetic pathways for acetylenic compounds.

Available plasmids for expression in yeast, such as pJK272, facilitate these applications by providing well-characterized expression systems . This enzyme represents an excellent example of how specialized plant enzymes can be harnessed for biotechnology through recombinant DNA approaches.

What insights does the study of Crepis alpina Delta (12) fatty acid dehydrogenase provide for understanding specialized plant metabolism?

The study of C. alpina acetylenase provides several key insights into specialized plant metabolism:

  • Multifunctionality: The enzyme's ability to perform both desaturation and acetylenation illustrates how plants evolve multifunctional enzymes from existing scaffolds to create metabolic diversity .

  • Regulatory complexity: The tissue-specific expression and activity patterns demonstrate how plants regulate specialized metabolism through multiple mechanisms, including transcriptional control, substrate competition, and enzyme co-expression .

  • Metabolic integration: The interaction between acetylenase and other fatty acid desaturases illustrates how specialized metabolism is integrated with primary metabolism through shared substrates and competing reactions .

  • Evolutionary adaptation: The presence of acetylenases in diverse plant lineages with different end products (crepenynic acid versus polyacetylenes) demonstrates convergent evolution of similar enzymatic functions for different ecological purposes .

These insights contribute to our broader understanding of how plants evolve complex metabolic pathways to produce specialized compounds with ecological and physiological significance, providing valuable lessons for metabolic engineering and synthetic biology approaches.

How might engineering Crepis alpina Delta (12) fatty acid dehydrogenase alter its catalytic properties?

Engineering C. alpina acetylenase could potentially alter its catalytic properties in several ways:

Such engineering efforts would build on our understanding of the structural features that distinguish acetylenases from standard desaturases, potentially yielding enzymes with novel or enhanced activities for biotechnological applications.

What experimental approaches are most effective for studying competition between desaturases and acetylenases for common substrates?

Several experimental approaches are effective for studying enzyme competition:

  • Co-expression studies: Expressing acetylenase alongside various FAD2 and FAD3 enzymes at controlled ratios in yeast or plant systems allows quantification of how competition affects product formation .

  • In vitro reconstitution: Purified or semi-purified enzyme preparations can be combined in controlled ratios with defined substrate concentrations to measure relative activities.

  • Metabolic flux analysis: Isotopic labeling of substrates combined with time-course product analysis can reveal how substrate flux is partitioned between competing enzymatic pathways.

  • Genetic manipulation: In plant systems, overexpression or suppression of individual enzymes can demonstrate how altering expression levels affects the balance of fatty acid products.

Research in C. alpina has demonstrated that both acetylenase expression level and co-expression of other desaturases contribute to the tissue specificity of crepenynate production . In flower heads, high expression of FAD3 likely competes with acetylenase for the linoleic acid substrate, preventing significant crepenynic acid accumulation despite acetylenase transcription .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.