Recombinant Dengue virus type 2 Genome polyprotein

Shipped with Ice Packs
In Stock

Description

Introduction to Dengue Virus Type 2 Genome Polyprotein

Dengue virus (DENV) is a significant global health burden affecting more than 50 million people annually across Southeast Asia, the Western Pacific, and the Americas. With no effective antiviral treatments currently available, understanding the molecular components of the virus remains crucial for therapeutic development . The dengue virus genome consists of a positive-sense RNA of approximately 11kb that encodes a single polyprotein which is subsequently cleaved into structural and non-structural proteins essential for viral replication and assembly .

The Dengue virus type 2 genome polyprotein serves as the primary translation product from the viral genomic RNA, comprising approximately 3400 amino acids. This polyprotein undergoes co- and post-translational processing by both viral and host proteases to generate the individual proteins necessary for viral lifecycle completion. The resulting proteins include three structural proteins (C, prM, and E) that form the virion components, and seven non-structural proteins (NS1, NS2A, NS2B, NS3, NS4A, NS4B, and NS5) that are primarily involved in viral RNA replication .

Genomic Organization and Polyprotein Processing

The dengue viral genome functions as both messenger RNA and template for RNA replication. Upon infection, the viral RNA is translated into a single polyprotein that spans the endoplasmic reticulum membrane. This polyprotein undergoes precise proteolytic processing to yield the individual viral proteins. The spatial arrangement of these proteins within the polyprotein is critical for their proper function, as their ordered cleavage enables the orchestrated assembly of viral replication complexes.

Structure and Characteristics of Recombinant Dengue Virus Type 2 Genome Polyprotein

Recombinant Dengue virus type 2 genome polyprotein refers to artificially produced versions of the viral polyprotein or its fragments, typically expressed in heterologous systems for research and biotechnological applications. These recombinant proteins often include affinity tags to facilitate purification and detection.

Recombinant Expression Systems

A significant example of recombinant Dengue virus type 2 genome polyprotein is the commercially available product expressed in E. coli systems. This recombinant protein (specifically amino acids 1066-1683 of the polyprotein) contains an N-terminal Histidine tag for purification purposes and represents a substantial portion of the viral polyprotein . The expression in bacterial systems allows for large-scale production of viral proteins that would otherwise be difficult to isolate from natural sources.

Physical and Biochemical Properties

The recombinant polyprotein fragment has distinct physical and biochemical characteristics that make it suitable for research applications. It is typically provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis . The storage conditions are critical for maintaining protein integrity, with recommended storage at -20°C/-80°C and avoidance of repeated freeze-thaw cycles which can compromise structural integrity .

Table 1: Characteristics of Recombinant Dengue Virus Type 2 Genome Polyprotein

PropertySpecification
Amino Acid Range1066-1683 of mature protein
Expression SystemE. coli
Affinity TagN-terminal His tag
Physical FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C with aliquoting for multiple use
ApplicationsSDS-PAGE, protein-protein interaction studies

Capsid Protein (C)

The capsid protein is essential for encapsidating the viral RNA genome. Structural studies have revealed that the DENV-2 capsid protein exists as a homodimer with a large dimerization surface contributed by two pairs of helices. Its structure exposes a fold where dimerization highlights characteristics likely to be functionally essential for virus assembly .

Membrane Protein (prM/M)

The membrane protein plays a crucial role in the arrangement and maturation of dengue virus particles. The precursor membrane protein (prM) consists of seven antiparallel β-strands stabilized by three disulfide bonds. During virus maturation, prM is cleaved by host furin protease, resulting in the mature M protein that functions as a transmembrane protein beneath the envelope protein shell. The pr peptide acts as a protective cap for the fusion loop of the E protein until viral release into the extracellular environment .

Envelope Protein (E)

The envelope protein is located on the viral surface and is essential for viral attachment to host cells. The E protein consists of three domains: Domain I (central region), Domain II (containing the fusion peptide), and Domain III (receptor binding domain). The E protein undergoes significant conformational changes during virus entry, facilitating fusion between viral and host cell membranes .

NS2A Protein

NS2A is a hydrophobic protein of approximately 22 kDa that serves as an important component of the viral replication complex. It contains five fundamental transmembrane segments that span the lipid bilayer of the endoplasmic reticulum membrane. NS2A plays vital roles in virus RNA synthesis and assembly, as well as antagonizing host immune responses .

NS3 Protein

NS3 is a multifunctional protein with protease, helicase, and NTPase activities. The first full-length structure of this multi-domain dengue virus replication protein has provided valuable insights into its function within the replication complex. NS3 interacts with other non-structural proteins, including NS4A and NS4B, which regulate its helicase activity .

NS4A and NS4B Proteins

NS4A and NS4B are integral membrane proteins that function in viral replication and virus-host interactions. NS4A contains two transmembrane domains, with its first domain forming an amphipathic helix involved in oligomerization. NS4B possesses three transmembrane domains and interacts with the helicase domain of NS3, influencing its RNA-binding properties .

NS5 Protein

NS5 is the largest and most conserved protein in the dengue virus, functioning as both a methyltransferase and RNA-dependent RNA polymerase. Recent structural studies have provided detailed insights into both domains of this critical replication protein .

Research Applications

Recombinant dengue virus type 2 genome polyprotein serves as a valuable tool for fundamental research into viral structure, function, and host interactions. The availability of purified recombinant proteins enables detailed biochemical and structural studies that would be challenging with native viral proteins. Researchers can use these recombinant proteins for:

  1. Protein-protein interaction studies to identify viral-host protein interactions

  2. Structural biology investigations using X-ray crystallography or cryo-electron microscopy

  3. Enzymatic assays to characterize viral protein activities

  4. Screening platforms for antiviral drug discovery

Diagnostic Applications

Recombinant viral proteins are crucial components in diagnostic assays for dengue virus infections. These proteins serve as antigens in serological tests for detecting anti-dengue antibodies in patient samples, helping differentiate between primary and secondary infections.

Vaccine Development

Understanding the structure and immunogenicity of dengue virus proteins is essential for vaccine development. Recombinant polyproteins and their cleaved products are being investigated as potential vaccine candidates, offering advantages in terms of safety and scalability compared to attenuated viral vaccines.

Drug Discovery

The recombinant proteins derived from the dengue virus polyprotein are valuable targets for antiviral drug discovery. By enabling high-throughput screening of compound libraries against viral protein functions, these recombinant proteins accelerate the identification of potential therapeutic agents.

Genetic Recombination in Dengue Viruses

While not directly related to the recombinant expression of dengue virus proteins for research purposes, it is important to note that natural recombination events occur in dengue viruses. These genetic recombination events contribute to viral evolution and diversity.

Natural Recombination Events

Studies have identified naturally occurring recombinant dengue virus strains, such as the dengue virus type 1 strain GD23/95, which contains three recombination regions located within the prM/E junction, NS1, and NS3 sequences . These natural recombination events play a significant role in the evolution of dengue viruses and may impact pathogenicity, vaccine development, and therapeutic approaches.

Implications for Antiviral Development

The occurrence of recombination in dengue viruses highlights the importance of targeting conserved regions of the viral polyprotein when developing antivirals or vaccines. Understanding these recombination events provides valuable insights into the evolution of dengue viruses and informs strategies for effective countermeasures.

Host-Virus Interaction Studies

Further investigation of the interactions between dengue virus proteins and host factors will enhance our understanding of viral pathogenesis and identify potential targets for therapeutic intervention. Recombinant viral proteins are invaluable tools for such studies, enabling detailed characterization of these interactions.

Novel Therapeutic Strategies

Research on recombinant dengue virus polyprotein and its components will continue to inform the development of novel antiviral strategies, including small-molecule inhibitors targeting viral enzymes, peptide-based inhibitors of protein-protein interactions, and RNA-based therapeutics aimed at suppressing viral replication.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Genome polyprotein; Fragments
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1066-1683
Protein Length
Full Length of Mature Protein
Species
Dengue virus type 2 (strain Tonga/EKB194/1974) (DENV-2)
Target Protein Sequence
AGVLWDVPSPPPVGKAELEDGAYRIKQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVLMH KGKRIEPSWADVKKDLISYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKPGLFRTNT GTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVTRSGAYVSAIAQTEKSIEDNPEIED DIFRKRRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPI RYQTPAIRAEHTGREIVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYI STRVEMGEAAGIFMTATPPGSRDPFPQSNAPIMDEEREIPERSWNSGHEWVTDFKGKTVW FVPSIKTGNDIAACLRKNGKRVIQLSRKTFDSEYVKTRTNDWDFVVTTDISEMGANFKAE RVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRIGRNPRNENDQYIYMGEPLE NDEDCAHWKEAKMLLDNINTPEGIIPSIFEPEREKVDAIDGEYRLRGEARKTFVDLMRRG DLPVWLAYKVAAEGINYADRRWCFDGTRNNQILEENVEVEIWTKEGERKKLKPRWLDARI YSDPLALKEFKEFAAGRK
Uniprot No.

Target Background

Function
The dengue virus type 2 genome polyprotein is a crucial component of the viral life cycle. It undergoes a series of cleavages to generate individual proteins, each with distinct functions: * **Envelope (E) Protein:** Binds to host cell surface receptors and mediates fusion between viral and cellular membranes. E is synthesized in the endoplasmic reticulum as a heterodimer with prM. The prM-E complex participates in virion budding and forms the immature particle's spikes. In the Golgi apparatus, low pH triggers prM-E dissociation and E homodimer formation. Incomplete prM cleavage is common, contributing to immune evasion. E is involved in immune evasion, pathogenesis, and viral replication. * **Precursor Membrane (prM) Protein:** Plays a role in immune evasion, pathogenesis, and viral replication. prM is cleaved from the polyprotein and targeted to three locations: the viral replication cycle, the plasma membrane, and the extracellular compartment. It is essential for viral replication and participates in the formation of the replication complex and recruitment of non-structural proteins to ER-derived membrane structures. * **Non-Structural Protein 1 (NS1):** Excreted as a hexameric lipoparticle that counteracts the host immune response. It antagonizes complement function, binds to macrophages and dendritic cells, and inhibits signaling from Toll-like receptor 3 (TLR3). * **Non-Structural Protein 2A (NS2A):** Contributes to the disruption of the host endothelial glycocalyx layer in pulmonary microvascular endothelial cells, leading to sialic acid degradation and heparan sulfate proteoglycan shedding. NS2A induces expression of sialidases, heparanase, and activates cathepsin L, ultimately activating heparanase. These effects are likely linked to the endothelial hyperpermeability observed in severe dengue disease. * **Non-Structural Protein 2B (NS2B):** A serine protease subunit required as a cofactor for NS3's serine protease activity. NS2B may also exhibit membrane-destabilizing activity and form viroporins. * **Non-Structural Protein 3 (NS3):** Possesses three enzymatic activities: serine protease, NTPase, and RNA helicase. The NS3 serine protease, in conjunction with NS2B, performs its autocleavage and cleaves the polyprotein at dibasic sites in the cytoplasm. The NS3 RNA helicase binds RNA and unwinds double-stranded RNA in the 3' to 5' direction. * **Non-Structural Protein 4A (NS4A):** Involved in the formation of the viral replication complex and membrane rearrangements. * **Non-Structural Protein 4B (NS4B):** Critical for the formation of the viral replication complex. * **Non-Structural Protein 5 (NS5):** Plays a key role in viral RNA replication, transcription, and capping.
Subcellular Location
[Envelope protein E]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein.; [Non-structural protein 1]: Secreted. Host endoplasmic reticulum membrane; Peripheral membrane protein; Lumenal side.; [Non-structural protein 2A]: Host endoplasmic reticulum membrane; Multi-pass membrane protein.; [Serine protease NS3]: Host endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side.

Q&A

What is the composition of the Dengue virus type 2 genome polyprotein?

The Dengue virus type 2 genome polyprotein consists of three structural proteins (capsid protein C, pre-membrane protein prM, and envelope protein E) and seven non-structural proteins (NS1, NS2a, NS2b, NS3, NS4a, NS4b, NS5). The structural proteins form the viral particle, while non-structural proteins are involved in viral replication and host interaction processes. The envelope protein E is particularly important as it binds to host cell surface receptors and mediates fusion between viral and cellular membranes . The capsid protein C plays a critical role in virus budding by binding to the cell membrane and encapsulating the viral RNA into a nucleocapsid that forms the core of mature virus particles .

What are the key domains of the DENV2 envelope protein and their functions?

The DENV2 envelope protein contains three distinct domains with specific functions in the viral life cycle:

DomainLocation (amino acids)Primary Functions
Domain I1-52, 132-193, 280-296Central domain; structural role in protein folding
Domain II53-131, 194-279Contains fusion peptide; mediates membrane fusion
Domain III297-400Receptor binding; major antigenic site; target for neutralizing antibodies

Domain III is of particular research interest as it contains the receptor-binding region and serves as a target for neutralizing antibodies, making it valuable for vaccine development . Multiple studies have focused on Domain III-based DNA vaccines, including the pE2D2 construct based on NGC DENV2 domain III fused to t-PA signal sequence, though this approach showed less efficacy compared to ectodomain-based vaccines .

How does the DENV2 NS3 protease function and why is it a target for antiviral development?

The NS3 protease of DENV2, in complex with its cofactor NS2B, is responsible for cleaving the viral polyprotein at multiple sites, which is essential for viral replication. The enzyme contains a catalytic triad (His51, Asp75, and Ser135) that forms the active site for proteolysis. Researchers have identified the P1 pocket and catalytic site as critical regions for inhibitor binding . The NS3 protease represents an attractive target for antiviral drug development because it is highly conserved across dengue serotypes and is absolutely required for viral replication. Structure-based approaches using computational docking programs like EUDOC have successfully identified small-molecule inhibitors that interact with the protease domain, some of which have demonstrated inhibition of viral replication in cell culture experiments .

What are the advantages and limitations of different expression systems for recombinant DENV2 proteins?

The choice of expression system significantly impacts the quality and functionality of recombinant DENV2 proteins. Here is a comparative analysis of common expression systems:

Expression SystemAdvantagesLimitationsApplications
E. coliFast growth, high yield, economical, well-established protocolsLacks post-translational modifications, protein folding issues, endotoxin concernsNon-glycosylated proteins, protein fragments, Domain III studies
Yeast (S. cerevisiae, P. pastoris)PTMs including glycosylation, proper protein folding, scalabilityNon-mammalian glycosylation patternsEnvelope proteins, virus-like particles
Mammalian cellsAuthentic PTMs, proper folding, native conformationExpensive, lower yields, complex protocolsFull-length envelope proteins, functional studies
Insect cellsHigh expression levels, near-native PTMs, proper foldingBaculovirus construction complexityStructural proteins, virus-like particles
Transgenic systems (plants/animals)Scalability, potentially lower costs for mass productionLong development time, regulatory challengesVaccine candidates, large-scale production

What methodological approaches have been effective for improving solubility and yield of recombinant DENV2 proteins?

Several strategies have proven effective for optimizing the expression of soluble, functional DENV2 proteins:

  • Fusion tags selection: Histidine tags (e.g., 6xHis) facilitate purification while enhancing solubility, as seen in the recombinant DENV2 envelope protein expressed in E. coli with >95% purity .

  • Codon optimization: Adapting the coding sequence to the expression host's codon usage bias significantly improves translation efficiency and yield, particularly important for DNA vaccines and protein expression systems .

  • Signal sequence incorporation: Including signal sequences like t-PA or prM signal peptides directs proteins to the secretory pathway, improving folding and solubility. The prM signal sequence has been effectively used in DNA vaccines encoding prM/E genes from DENV2 NGC virus .

  • Domain-focused expression: Expressing specific domains (like Domain III) rather than full-length proteins can overcome folding challenges, though this approach may sacrifice some conformational epitopes .

  • Expression temperature modification: Lowering the expression temperature (typically to 16-25°C) slows protein synthesis, allowing more time for proper folding and reducing inclusion body formation.

These approaches should be systematically evaluated for each specific DENV2 protein construct to determine optimal expression conditions.

What assays are recommended for evaluating the functionality of recombinant DENV2 envelope proteins?

Several complementary assays are essential for comprehensive functional characterization:

  • Structural integrity assessment: Circular dichroism (CD) spectroscopy to verify secondary structure elements and proper folding.

  • Receptor binding assays: Surface plasmon resonance (SPR) or cell-based binding assays to evaluate interaction with host receptors.

  • Fusion activity tests: pH-dependent liposome fusion assays to assess the fusion functionality of envelope proteins.

  • Antibody recognition studies: ELISA and neutralization assays with conformation-dependent monoclonal antibodies to confirm native-like epitope presentation.

  • Virus-like particle (VLP) formation: Electron microscopy to verify assembly into VLPs for prM/E constructs. DNA vaccines based on prM/E proteins can potentially produce VLPs, which may induce antibodies against conformational epitopes essential for viral neutralization .

These assays provide critical information about whether recombinant proteins retain functional characteristics of native viral proteins, which is essential for vaccine development and structural studies.

How can researchers assess the immunogenicity of recombinant DENV2 proteins in preclinical models?

A systematic approach to immunogenicity assessment includes:

  • Antibody response measurement: Quantification of total binding antibodies via ELISA and functionally relevant neutralizing antibodies through plaque reduction neutralization tests (PRNT). Studies have shown variable neutralizing antibody (NAb) responses to different vaccine constructs, with some tetravalent formulations inducing long-term NAb against all four serotypes .

  • T-cell response evaluation: ELISpot assays for IFN-γ and IL-4 production, intracellular cytokine staining, and proliferation assays to characterize T-cell responses. Polyfunctional T cells producing IFN-γ and TNF-α have been associated with protection following immunization with certain constructs .

  • Challenge studies: In appropriate animal models (AG129 mice, non-human primates), viral challenge followed by viremia measurement and clinical outcome assessment. The pE1D2 vaccine showed protection that was dependent on CD4+ T lymphocytes, as depletion of these cells completely abolished protection .

  • Cross-reactivity analysis: Evaluation of immune responses against heterologous DENV serotypes to assess potential for cross-protection or antibody-dependent enhancement (ADE).

  • Adjuvant comparative studies: Systematic comparison of different adjuvant formulations to optimize immune response profiles. For example, the TVDV-Vaxfectin formulation failed to elicit efficient NAb responses but induced IFN-γ production in about 80% of volunteers in clinical trials .

What strategies have been employed to develop recombinant protein-based DENV2 vaccines?

Multiple approaches have been explored in the development of recombinant protein-based vaccines against DENV2:

  • Subunit vaccines: Focused on envelope protein or its domains, particularly Domain III, which contains important neutralizing epitopes. These have shown variable efficacy in animal models .

  • Virus-like particles (VLPs): Self-assembling structures formed by co-expression of structural proteins (prM and E) that mimic the native virus structure without infectious genetic material. VLPs generated by prM/E-based DNA vaccines have shown promise in inducing antibodies against conformational epitopes essential for viral neutralization .

  • Fusion protein constructs: Engineering of chimeric proteins combining DENV2 antigens with immunostimulatory molecules to enhance immunogenicity. Multiple E protein epitopes have been identified that are recognized by CD4+ and/or CD8+ T cells after immunization with specific constructs, resulting in production of IFN-γ and TNF-α .

  • Tetravalent formulations: Combination of components from all four DENV serotypes to provide balanced immune responses. Several DNA-based tetravalent formulations have been developed, including one with sequences from Hawaii, Tr1751, H87 and H241 strains (DENV1-4 respectively) that induced T-cell activation with high IL-4 and IFN-γ production and long-term neutralizing antibody responses against all four serotypes .

  • Heterologous prime-boost strategies: DNA vaccination followed by recombinant protein boosting to enhance both cellular and humoral immunity. Clinical trials with dengue DNA immunizations have shown no genomic integration or neoplastic alterations that might pose safety risks .

The development of these approaches aims to overcome the limitations of the only licensed dengue vaccine (Dengvaxia), which has shown inability to confer balanced protection against all serotypes .

What are the major challenges in developing an effective tetravalent vaccine against all dengue serotypes?

Developing effective tetravalent vaccines presents several significant challenges:

  • Balanced immunogenicity: Achieving equivalent immune responses against all four serotypes is difficult due to viral interference and immunodominance. Some tetravalent formulations have shown variable antibody titers against different serotypes, with pcD4ME eliciting higher antibody levels when administered in a tetravalent formulation compared to monovalent administration .

  • Antibody-dependent enhancement (ADE): Partial immunity against one serotype may enhance infection with another serotype, potentially causing severe disease. This phenomenon complicates vaccine design and safety assessment.

  • Antigenic diversity within serotypes: Multiple genotypes exist within each serotype, requiring vaccines to protect against this intra-serotypic variation. Studies of prM/E vaccines based on distinct genotypes of DENV1 and DENV3 revealed higher neutralizing antibody titers after immunization with genes from homologous genotypes compared to heterologous ones .

  • Durability of protection: Ensuring long-lasting immunity against all serotypes simultaneously remains challenging. Some DNA vaccine formulations have demonstrated long-term neutralizing antibody presence, detectable 30 weeks after the first DNA dose .

  • Epitope preservation: Maintaining critical conformational epitopes in recombinant proteins or expression systems. DNA shuffling strategies have been explored to create vaccines targeting all dengue serotypes in a single construct, though these approaches raise concerns about altered protein folding that could impact antigenic properties .

Researchers have employed various strategies to address these challenges, including novel adjuvant formulations, optimized antigen design, and heterologous prime-boost approaches.

How can structure-based approaches facilitate the development of DENV2 protease inhibitors?

Structure-based drug design has emerged as a powerful approach for developing DENV2 protease inhibitors:

  • Computational screening: Programs like EUDOC can screen small-molecule libraries for compounds that dock into specific pockets of the DENV2 NS3 protease domain. This approach has identified promising inhibitor candidates that demonstrated favorable "energies" in computational models .

  • Crystal structure utilization: The availability of crystal structures of the DEN2V NS3 protease domain and inhibitor-bound structures provides valuable templates for rational drug design. Studies have utilized the apo-structure and the Bowman-Birk inhibitor-bound structure to identify compounds that interact with the P1 pocket and catalytic site .

  • Structure-activity relationship (SAR) studies: Systematic modification of lead compounds based on structural insights to improve potency and specificity. Preliminary protease activity assays have shown that more than half of computer-identified candidates demonstrated in vitro inhibition of the DEN2V protease .

  • Allosteric site targeting: Identification of non-catalytic sites that affect enzyme function when bound, potentially offering more specificity.

  • Fragment-based approaches: Building inhibitors incrementally by identifying small molecular fragments that bind to different regions of the protease.

The most promising compounds identified through these approaches have demonstrated inhibition of viral replication in cell culture experiments, suggesting potential for further development as anti-flaviviral drugs .

What genomic engineering strategies can improve the design of recombinant DENV2 constructs?

Advanced genomic engineering strategies have significantly enhanced recombinant DENV2 construct design:

  • Codon optimization: Systematic adaptation of the viral coding sequence to the expression host's codon usage bias significantly improves translation efficiency and protein yield. This approach has been applied to DNA shuffling strategies for developing tetravalent vaccines .

  • RNA optimization: Modification of RNA secondary structures to enhance mRNA stability and translation efficiency while avoiding undesired cryptic splice sites or regulatory elements.

  • Directed evolution: Application of molecular evolution techniques to select for improved protein variants with enhanced stability, immunogenicity, or expression.

  • DNA shuffling: Creation of chimeric constructs combining sequences from multiple serotypes to develop broadly protective immunogens. This approach has been used to create tetravalent vaccines, though concerns about altered protein folding affecting antigenic properties remain .

  • Signal sequence optimization: Engineering of secretion signals to enhance protein export and folding, as demonstrated in the fusion of DENV2 domain III to the t-PA signal sequence .

  • Fusion partner selection: Strategic selection of fusion tags or carrier proteins to enhance solubility, folding, and immunogenicity of the target antigen.

These genomic engineering approaches continue to advance the field, facilitating the development of next-generation vaccine candidates and research tools.

What are common challenges in expressing recombinant DENV2 proteins and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant DENV2 proteins:

  • Protein insolubility and inclusion body formation:

    • Solution: Optimize expression conditions (lower temperature, reduced inducer concentration), add solubility-enhancing tags, or employ refolding protocols from inclusion bodies.

    • Example: The recombinant DENV2 envelope protein fragment (aa 298-400) expressed in E. coli with a 6xHis tag achieved >95% purity and suitable properties for SDS-PAGE .

  • Incorrect disulfide bond formation:

    • Solution: Express in specialized E. coli strains with oxidizing cytoplasm, use periplasmic targeting, or switch to eukaryotic expression systems.

    • Context: Proper disulfide bonding is critical for correct folding of envelope proteins, affecting both structure and antigenicity.

  • Non-native glycosylation patterns:

    • Solution: Select appropriate expression systems based on glycosylation requirements; use mammalian cells for authentic patterns or engineered yeast strains.

    • Consideration: Different expression hosts have distinct glycosylation capabilities, with E. coli lacking glycosylation machinery, yeast providing non-mammalian patterns, and mammalian cells offering near-native modifications .

  • Proteolytic degradation:

    • Solution: Add protease inhibitors during purification, optimize harvesting timing, or modify sequence to remove protease-sensitive sites.

  • Low expression yields:

    • Solution: Optimize codon usage, promoter strength, culture conditions, and induction parameters; consider alternative expression systems.

    • Impact: Expression yield significantly affects the feasibility of structural studies and vaccine production.

  • Protein aggregation during purification:

    • Solution: Adjust buffer conditions (pH, ionic strength, additives), optimize purification protocols, and implement quality control measures.

Addressing these challenges requires systematic optimization and often a combination of molecular and process engineering approaches.

How can researchers verify the proper folding and antigenicity of recombinant DENV2 envelope proteins?

Verifying proper folding and antigenicity requires a multi-faceted analytical approach:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Thermal stability analyses to determine melting temperature and stability profiles

    • Dynamic light scattering (DLS) to evaluate size distribution and aggregation state

    • Size exclusion chromatography to assess oligomeric state and homogeneity

  • Conformational antibody binding:

    • ELISA with conformation-dependent monoclonal antibodies that recognize native epitopes

    • Surface plasmon resonance (SPR) to determine binding kinetics and affinity constants

    • Flow cytometry to assess cell surface binding of recombinant proteins

  • Functional assays:

    • Cell binding assays to verify receptor interaction capabilities

    • Fusion assays to confirm conformational changes in response to pH

    • Hemagglutination assays as a surrogate for functional activity

  • Immunological validation:

    • Comparison of neutralizing antibody responses elicited by recombinant proteins versus native virus

    • Epitope mapping to verify presentation of critical neutralizing determinants

    • T-cell epitope recognition analyses, as studies have identified multiple E protein epitopes recognized by CD4+ and/or CD8+ T cells after immunization

  • Structural studies:

    • X-ray crystallography or cryo-electron microscopy to determine three-dimensional structure

    • Hydrogen-deuterium exchange mass spectrometry to probe protein dynamics and accessibility

Proper folding directly impacts immunogenicity and protective efficacy, making these verification steps critical for vaccine development and structural biology research focused on DENV2 proteins.

What emerging technologies show promise for enhancing recombinant DENV2 vaccine development?

Several innovative technologies are poised to transform recombinant DENV2 vaccine research:

  • Structure-guided immunogen design: Using high-resolution structural information to engineer stabilized pre-fusion conformations or to expose critical neutralizing epitopes while concealing potentially enhancing ones.

  • Self-amplifying mRNA platforms: Combining the advantages of DNA vaccines and recombinant protein approaches by delivering mRNA encoding DENV antigens that can self-amplify, potentially offering stronger and more durable immune responses.

  • Nanoparticle display systems: Multivalent presentation of DENV2 antigens on nanoparticles to enhance immunogenicity through improved uptake by antigen-presenting cells and lymph node targeting.

  • Computationally optimized broadly neutralizing epitopes: Identification and optimization of conserved epitopes that can induce antibodies capable of neutralizing all DENV serotypes.

  • CRISPR-enabled vaccine platforms: Application of gene editing technologies to develop novel vaccine vectors or to modify host responses to vaccination.

  • Systems vaccinology approaches: Integration of multi-omics data to predict vaccine efficacy and identify correlates of protection to guide rational vaccine design.

These emerging technologies may help overcome the limitations of current approaches and address the challenge of developing a universally effective dengue vaccine that provides balanced protection against all serotypes.

What are the key unresolved questions in understanding DENV2 polyprotein processing and function?

Despite significant advances, several critical questions remain regarding DENV2 polyprotein processing and function:

  • Temporal regulation of polyprotein processing: How is the sequential cleavage of the polyprotein regulated to ensure proper viral assembly? Understanding the order and kinetics of cleavage events could reveal new intervention points.

  • Host factors in polyprotein processing: What host cellular factors interact with and modulate viral polyprotein processing? Identification of these factors could provide novel therapeutic targets.

  • Structural transitions during virus maturation: How do structural proteins rearrange during maturation? The inefficient prM-E cleavage results in partially matured virions that may play a role in immune evasion .

  • Non-structural protein interactions: What is the full interactome of DENV2 non-structural proteins with host proteins? NS3 protease is a potential target for antiviral drugs since it is required for virus replication .

  • Determinants of serotype-specific pathogenicity: Which specific polyprotein components contribute to the varying pathogenicity observed between dengue serotypes and genotypes?

  • Mechanisms of antibody-dependent enhancement: How do antibodies targeting specific epitopes on viral proteins contribute to enhanced infection in subsequent exposures to heterologous serotypes?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.