Recombinant Dense granule protein 3 (GRA3)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Toxoplasma Pathogenesis

GRA3 contributes to multiple stages of infection:

Parasitophorous Vacuole Formation

  • Membrane Integration: The transmembrane domain anchors GRA3 to the PVM, stabilizing the vacuole and enabling nutrient uptake .

  • Golgi Interaction: GRA3 induces tubule formation from host Golgi, redirecting organelle material into the vacuole .

Immune Evasion

  • Suppression of CD8+ T Cell Activity: GRA3-deficient mutants show reduced cyst survival due to enhanced susceptibility to perforin-mediated T cell responses .

  • Downregulation of Antigen Presentation: GRA3 disrupts Golgi-dependent MHC-I antigen processing, evading host immune detection .

ER Stress and Apoptosis

  • PERK Pathway Activation: Overexpression of GRA3 in neuronal cells induces ER stress markers (GRP78, p-PERK, CHOP) and apoptosis via caspase-12/-3 .

  • Strain-Specific Expression: Higher GRA3 levels in less virulent type II (ME49) and Chinese 1 Wh6 strains correlate with reduced neurovirulence .

Recombinant Production

Recombinant GRA3 is produced via:

  1. Cloning: GRA3 gene fragment (aa43–114) fused with a His tag for affinity purification.

  2. Expression: E. coli cytoplasmic expression yields ~10.8 kDa protein .

Serological Diagnostics

GRA3 is integrated into chimeric antigens (e.g., EC2, EC3) for improved serotyping:

Diagnostic ApplicationPerformanceSources
IgG/IgM Rec-ELISAComparable sensitivity/specificity to whole-cell assays for acquired toxoplasmosis
Congenital ToxoplasmosisEnhanced postnatal diagnosis using GRA3-containing chimeric antigens
Strain TypingGRA3 peptide combinations (GRA3, GRA6, GRA7) enable serotyping of type II/III infections in livestock

Mechanistic Insights

  • ER Stress in Neurodegeneration: GRA3-induced apoptosis in neuronal cells suggests a role in toxoplasmic encephalitis pathology .

  • Cyst Maintenance: GRA3 deficiency reduces cyst burden in SCID mice, highlighting its role in chronic infection persistence .

Therapeutic Potential

  • Vaccine Target: GRA3’s immunogenicity makes it a candidate for vaccine development .

  • Biomarker: GRA3 expression levels may predict strain virulence and clinical outcomes .

Future Directions

  1. Structural Studies: Elucidating GRA3-Golgi interactions to design ER-targeted therapies.

  2. Diagnostic Standardization: Optimizing GRA3-based assays for cross-species serotyping.

  3. Immunomodulatory Interventions: Exploiting GRA3’s role in antigen presentation to enhance anti-parasite immunity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
GRA3; Tg556; Dense granule protein 3; P30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Toxoplasma gondii
Target Names
GRA3
Target Protein Sequence
MDRTICPFFIQSFTMSTALKRLIPFLVPFVVFLVAAALGGLAADQPGNHQALAEPVTGVG EAGVSPVNEAGESYSSATSGVQEATAPGAVLLEAIDAESDKVDNQAEGGERMKKVEEELS LLRRELYDRTDRPGLKRAVILSLGTSALIAGRMFSSTLRAAVPWYAVAFNAIVAAYYIRK VLTYRRRVMTKRQPFMSSVKNFFRRRPKDGGAGVDKASKKQT
Uniprot No.

Target Background

Function

Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane. This interaction is mediated by the association of GRA3 and host CAMLG. The GRA3 ER retrieval motif directly inserts into the host ER membrane, facilitating ER recruitment to the PVM.

Subcellular Location
Cytoplasm. Host endoplasmic reticulum. Parasitophorous vacuole membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of GRA3 and how has its characterization evolved?

GRA3 is a type I transmembrane protein with a molecular weight of approximately 24 kDa. The correct characterization of GRA3 required resolving a significant confusion in the scientific literature, as the previously published sequence was actually an artificial chimera of two different proteins. The authentic GRA3 possesses an N-terminal secretory signal sequence and a transmembrane domain consistent with its insertion into the parasitophorous vacuole membrane (PVM) . The protein contains a distinctive cytoplasmic dilysine (KKXX) endoplasmic reticulum retrieval motif at its C-terminus, which explains its strong association with the PVM and potentially with the host cell endoplasmic reticulum .

How can researchers effectively express and purify recombinant GRA3?

For recombinant expression of GRA3, researchers should consider the following methodological approach:

  • Clone the authentic GRA3 sequence (24 kDa protein recognized by monoclonal antibody 2H11) into an appropriate expression vector

  • Express the protein in a eukaryotic expression system (preferably mammalian or insect cells) to ensure proper folding and post-translational modifications

  • Include the N-terminal signal peptide if targeting to secretory pathway is desired, as this sequence is both necessary and sufficient for directing the protein to dense granules and the parasitophorous vacuole

  • Incorporate a suitable purification tag (His, GST, or FLAG) that doesn't interfere with the protein's structure or function

  • Purify using affinity chromatography followed by size exclusion chromatography to ensure homogeneity

  • Validate the recombinant protein using antibodies specific to GRA3, confirming it matches the 24 kDa size observed in T. gondii excretory-secretory antigen preparations

What homologs of GRA3 exist in related parasites and how can they inform comparative studies?

A GRA3 homolog has been identified in Neospora caninum, a closely related apicomplexan parasite . When designing comparative studies between T. gondii and N. caninum GRA3 proteins, researchers should:

  • Align the sequences to identify conserved and divergent regions

  • Focus on the conservation of functional domains, particularly the signal peptide, transmembrane domain, and the dilysine KKXX motif

  • Compare subcellular localization patterns to determine if the N. caninum homolog similarly associates with the parasitophorous vacuole membrane

  • Evaluate cross-reactivity of antibodies between the two proteins to assess structural similarities

  • Examine functional conservation through complementation studies in knockout parasites

How can GRA3 peptides be utilized for strain typing of Toxoplasma gondii infections?

GRA3 peptides, particularly the GRA3-I/III-43 vs. GRA3-II-43 pair, can be valuable tools for discriminating between different T. gondii strain types in serological samples. This approach is based on differential reactivity patterns against strain-specific peptide variants . When implementing this methodology:

  • Select appropriate peptide pairs (GRA3-I/III-43 vs. GRA3-II-43) that show strain-specific reactivity

  • Establish prediction rules based on the ratio of reactivity between the peptides, considering both the predominance (ratio >1 or <1) and the intensity (non-reactive, weak, or strong) of each peptide reaction

  • Combine results from GRA3 peptides with other markers (GRA6, GRA7) for improved accuracy and reliability

  • Be aware that the GRA3-I/III-43 vs. GRA3-II-43 ratio shows variable prediction rates across experimental settings—in some studies reaching 94% accuracy in experimentally infected sheep, but only 50% in samples from naturally infected animals

  • Consider species-specific differences in peptide reactivity; patterns observed in one host species may not directly translate to others

How does the performance of GRA3 peptides compare with other dense granule protein markers for parasite strain discrimination?

When comparing the efficacy of different dense granule protein peptides for strain typing:

  • GRA6 peptides (particularly GRA6-II-44 vs. GRA6-III-44 and GRA6-I/III-213 vs. GRA6-II-214) generally demonstrate higher prediction accuracy than GRA3 in sheep and pig samples, with correct prediction rates of 90% and 85% respectively

  • GRA3-I/III-43 vs. GRA3-II-43 shows moderate effectiveness, with significant variation between experimental and natural infection samples (from 94% in experimental to only 50% in natural infections)

  • GRA7-III-224 vs. GRA7-II-224 demonstrates inconsistent performance across species, showing poor results in sheep but good prediction accuracy in pigs

  • For optimal strain typing results, implement a combined approach using multiple peptide pairs (at least GRA6-213, GRA6-44, and GRA3-43) and establish strain identification based on concordant results from at least two markers

  • Sample at least two different time points from each animal to confirm results, as temporal variations in antibody responses may affect prediction accuracy

What are the critical considerations when designing experiments to analyze GRA3 trafficking and localization?

When investigating GRA3 trafficking and localization within host-parasite interactions:

  • Utilize the signal peptide of GRA3 fused with reporter proteins (such as GFP) to study targeting to dense granules and the parasitophorous vacuole, as this sequence has been demonstrated to be both necessary and sufficient for proper localization

  • Pay special attention to the dilysine "KKXX" endoplasmic reticulum retrieval motif at the C-terminus, which explains GRA3's association with the parasitophorous vacuole membrane and potentially with host cell ER

  • Employ high-resolution microscopy techniques (super-resolution, electron microscopy) to precisely identify the localization pattern within dense granules and at the parasitophorous vacuole membrane

  • Design deletion or mutation constructs specifically targeting the transmembrane domain and the KKXX motif to assess their contribution to proper protein trafficking

  • Consider co-localization studies with ER markers to investigate the interaction between the parasitophorous vacuole and host ER, which may be mediated by GRA3's KKXX motif

What approaches can resolve contradictory findings regarding GRA3 structure and function?

When encountering contradictory information about GRA3 in the literature:

  • Acknowledge the historical confusion regarding GRA3's sequence, recognizing that the previously published sequence was an artificial chimera of two different proteins—one 65 kDa protein sharing the C-terminus with the published sequence and a 24 kDa protein (the authentic GRA3) sharing the N-terminal region

  • Verify which version of GRA3 previous studies were referencing, particularly those published before the sequence correction

  • Use the monoclonal antibody 2H11 (known to react with T. gondii dense granules) to confirm you are working with the authentic 24 kDa GRA3 protein

  • When comparing results across studies, examine whether experimental differences (expression systems, strain types, host species) might explain apparent contradictions

  • Implement multiple detection methods (immunoblotting, immunofluorescence, mass spectrometry) to validate findings and resolve discrepancies

How should researchers optimize serological assays using GRA3 peptides for different host species?

When adapting GRA3-based serological assays across different host species:

  • Recognize that peptide reactivity patterns vary significantly between species—peptides that perform well in one species may show poor results in others

  • For sheep samples, combine at least GRA3-43, GRA6-213, and GRA6-44 peptide pairs for reliable strain typing, with strain identification based on concordant results from at least two markers

  • For pig samples, the combination of GRA6-44, GRA6-213/214, and GRA7-224 peptides appears more effective than GRA3 peptides

  • Establish species-specific thresholds and prediction rules based on empirical testing rather than assuming transferability across species

  • Include appropriate positive and negative controls specific to each host species to account for background reactivity and non-specific binding

  • Test additional peptides, including those that may have been ruled out in other species, as they might perform differently in your target species

What experimental controls are essential when evaluating GRA3's role in host-parasite interactions?

To rigorously assess GRA3's functions in host-parasite interactions:

  • Generate GRA3 knockout parasites using CRISPR-Cas9 or other gene editing approaches to directly evaluate the protein's necessity for infection processes

  • Include complementation controls where the knockout is rescued with either wild-type GRA3 or various mutant forms (particularly those affecting the signal peptide, transmembrane domain, or KKXX motif)

  • Implement domain swapping experiments to assess the specificity of GRA3 functions compared to other dense granule proteins

  • Compare results across multiple parasite strains (types I, II, and III) to account for strain-specific variations in GRA3 function

  • Use heterologous expression systems to evaluate GRA3's intrinsic properties independent of other parasite factors

How can researchers address the variability in GRA3 peptide performance across different host species and infection settings?

The significant variability in GRA3 peptide performance across species and between experimental versus natural infections presents ongoing challenges . To address these issues:

  • Develop comprehensive peptide libraries covering diverse regions of GRA3 from different strain types

  • Conduct systematic screening of these peptides across multiple host species to identify species-specific reactivity patterns

  • Establish standardized protocols and thresholds for each host species to improve reproducibility

  • Investigate the underlying immunological factors that contribute to differential reactivity patterns between species

  • Consider advanced techniques like phage display to identify optimal antigenic epitopes for each host species

  • Implement machine learning approaches to analyze complex serological data and identify predictive patterns that may not be apparent through conventional analysis

What approaches can improve the resolution of GRA3-based strain typing beyond the current type I, II, and III classifications?

Current GRA3-based typing primarily focuses on classical type I, II, and III strains, but opportunities exist to expand this approach to atypical strains:

  • Sequence GRA3 genes from a diverse collection of atypical T. gondii strains to identify strain-specific variations

  • Design and synthesize peptides representing unique epitopes in atypical strains

  • Test these peptides against sera from animals infected with well-characterized atypical strains to establish reactivity patterns

  • Develop multiplexed assays incorporating peptides from GRA3, GRA6, GRA7, and other antigenic proteins to improve strain discrimination capacity

  • Validate the expanded typing system using naturally infected samples from diverse geographical regions where atypical strains are prevalent

  • Use this approach to investigate associations between strain types and disease severity or epidemiological patterns

How might advanced computational approaches enhance our understanding of GRA3 structure-function relationships?

Computational approaches can provide valuable insights into GRA3 biology:

  • Apply protein structure prediction tools (such as AlphaFold) to model the three-dimensional structure of GRA3, with particular focus on the transmembrane domain and KKXX motif

  • Use molecular dynamics simulations to investigate GRA3's interaction with membranes, especially its insertion into the parasitophorous vacuole membrane

  • Employ protein-protein interaction prediction algorithms to identify potential binding partners for GRA3 within both parasite and host cells

  • Analyze sequence conservation and selection pressures across different T. gondii strains and related apicomplexan parasites to identify functionally important regions

  • Implement systems biology approaches to integrate GRA3 into broader parasite secretome networks, providing context for its functions

How can researchers reconcile contradictory findings regarding GRA3 peptide effectiveness across different studies?

When confronted with contradictory results regarding GRA3 peptide effectiveness:

  • Systematically compare methodological differences between studies, including peptide synthesis methods, assay formats, and data analysis approaches

  • Consider parasite strain variations used in different studies, as subtle genetic differences might affect epitope presentation

  • Analyze host-specific factors that might influence antibody responses, including genetic background, age, and prior exposure to related pathogens

  • Implement standardized positive and negative controls across studies to enable direct comparison of results

  • Design multi-laboratory validation studies using identical reagents and protocols to assess reproducibility

  • Utilize statistical approaches that account for both biological and technical variability when comparing results across studies

What strategies can help researchers identify and address self-contradictory data within GRA3 studies?

To identify and address self-contradictory data within your own GRA3 research:

  • Implement systematic internal validation procedures, testing the same samples using multiple methodological approaches

  • Carefully examine outliers and unexpected results, which may reveal important biological insights rather than simply representing technical errors

  • Consider temporal factors in experimental design, as antibody reactivity patterns may change over the course of infection

  • Evaluate whether contradictions might result from batch effects in reagents or protocol drift over time

  • Implement blinded analysis where appropriate to minimize confirmation bias

  • Document and report all contradictory findings transparently in publications, as these contradictions may point to important biological complexities

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.