Recombinant Dense granule protein 4 (GRA4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GRA4; H11; Dense granule protein 4; Protein GRA 4; Antigen H11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-345
Protein Length
full length protein
Species
Toxoplasma gondii
Target Names
GRA4
Target Protein Sequence
GECSFGSHLADMAGLSGRHDKERHQAKKRYYHSMYGNQTPYPYANGQQASPPPQGQLLII QNPDGSFMIVDQQGVPQVPQAAGGPGSPMNGGYYMPTGVYTAQVVPGTPGHPVQAIPQQP LRTQATATYYHPAAVPPPGPSVFVFTPSSVQPGAEVTPGYSGLQLRQQSQYGYSYPGTTS TPTPPPPASYGYPVFPAFPRLPAFSDSVSVSTEDSGLTGVKDSSSSESTVTPADEAASES EEGDKTSRKSKVKKGILTGLGVAATLAAAAAAAKAVKGFGGTRTSTAPAEAGKTELDDGY RPPPFNPRPSPYAELLKDLERMRKE
Uniprot No.

Target Background

Function
A major granular component involved in excreted-secreted antigen (ESA) immunity.
Subcellular Location
Secreted. Parasitophorous vacuole lumen. Parasitophorous vacuole membrane. Cytoplasmic vesicle, secretory vesicle. Note=Located in dense granules of tachyzoites. Upon infection, secreted into the parasitophorous vacuole (PV) and targeted to the microvillus membranous network.

Q&A

What is Dense Granule Protein 4 (GRA4) and what role does it play in parasite biology?

Dense Granule Protein 4 (GRA4) is a secretory protein found in apicomplexan parasites, including Toxoplasma gondii and Neospora caninum. It is stored in specialized secretory vesicles called dense granules, which bud directly from the trans-Golgi network (TGN) . GRA4 is secreted into the parasitophorous vacuole (PV) during and after host cell invasion, where it contributes to the establishment and maintenance of the intracellular environment necessary for parasite survival and replication. Dense granule proteins like GRA4 are crucial for adapting the intracellular environment and are key to parasite survival and pathogenicity . The secretion of these proteins occurs within minutes of invasion and continues during intracellular development, allowing the parasite to modify its environment for optimal growth and to evade host immune responses.

How does recombinant GRA4 differ from native GRA4 in structural and functional aspects?

Recombinant GRA4 is produced through heterologous expression systems (commonly E. coli) using synthetic gene constructs or cloned parasite genes, while native GRA4 is naturally expressed by the parasite. The recombinant protein may differ from the native form in several ways: post-translational modifications (such as glycosylation patterns) are often absent or different in prokaryotic expression systems; the recombinant protein may include additional sequences such as tags for purification or detection; and the folding may differ slightly, potentially affecting epitope presentation. Despite these differences, recombinant GRA4 maintains essential antigenic properties that make it valuable for immunological studies and diagnostic applications . When properly purified and validated, recombinant GRA4 can effectively mimic the native protein in serological assays, with studies showing sensitivity and specificity comparable to those using native antigens.

What are the primary applications of recombinant GRA4 in parasite research?

Recombinant GRA4 serves multiple purposes in parasite research:

  • Diagnostic serology: It functions as an antigen in diagnostic assays like iELISA and Western blot for detecting infections caused by Toxoplasma gondii or Neospora caninum .

  • Vaccine development: As an immunogenic protein, it's studied as a potential component of subunit vaccines.

  • Host-pathogen interaction studies: It helps researchers investigate how parasites modulate host cell functions.

  • Immunological research: It's used to study specific antibody responses during different infection phases.

  • Structure-function analyses: Understanding the molecular mechanisms of GRA4 action requires purified protein for in vitro studies.

These applications contribute to our understanding of parasite biology and pathogenesis while advancing disease diagnosis and control strategies.

What are the optimal expression systems for producing functional recombinant GRA4?

The most commonly used and generally optimal system for recombinant GRA4 expression is Escherichia coli due to its simplicity, cost-effectiveness, and high yield. Studies have successfully utilized E. coli systems to produce recombinant dense granule proteins, including GRA4 . For research requiring post-translational modifications closer to native proteins, eukaryotic expression systems such as yeast (Pichia pastoris or Saccharomyces cerevisiae), insect cells (using baculovirus vectors), or mammalian cells might be more appropriate, though these are typically more complex and expensive to implement. The choice of expression system should be guided by the specific research question, particularly whether post-translational modifications are critical for the protein's function or antigenicity being studied. When expressing in E. coli, it's important to optimize codon usage for prokaryotic expression, select appropriate promoters (such as T7 for high-level expression), and determine whether the protein should be expressed with fusion tags (such as His6, GST, or MBP) to facilitate purification and potentially improve solubility.

What purification strategies yield the highest purity and biological activity for recombinant GRA4?

A multi-step purification approach typically yields the highest purity and biological activity for recombinant GRA4:

  • Affinity chromatography: If the recombinant protein includes a tag (such as His6), affinity purification provides an excellent first step. For His-tagged proteins, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is most common .

  • Size exclusion chromatography: This separates proteins based on molecular size and can remove aggregates and degradation products.

  • Ion exchange chromatography: This can further purify based on protein charge.

  • Endotoxin removal: Critical for proteins intended for immunological studies or in vivo experiments.

Throughout purification, it's important to monitor protein integrity using techniques such as SDS-PAGE, which has been used to confirm the molecular weight of recombinant NcGRA4 at approximately 32 kDa . Western blotting can also verify the identity and antigenicity of the purified protein. Optimal buffer conditions (pH, salt concentration, presence of reducing agents) should be determined empirically to maintain protein stability and activity. The purification protocol should be designed to minimize exposure to conditions that could lead to protein denaturation or aggregation.

How can researchers troubleshoot common issues in GRA4 expression and purification?

When encountering challenges in GRA4 expression and purification, researchers should consider the following troubleshooting approaches:

For poor expression levels:

  • Optimize codons for the expression host

  • Test different expression vectors and promoters

  • Vary induction conditions (temperature, inducer concentration, time)

  • Consider alternative expression hosts

For inclusion body formation:

  • Lower induction temperature (e.g., 16-20°C)

  • Reduce inducer concentration

  • Co-express with chaperones

  • Add solubility-enhancing tags (like MBP or SUMO)

  • Develop refolding protocols if necessary

For low purity:

  • Optimize binding and washing buffers

  • Introduce additional purification steps

  • Consider alternative affinity tags

For protein degradation:

  • Add protease inhibitors

  • Reduce purification time

  • Maintain samples at cold temperatures

  • Test different buffer compositions for stability

For endotoxin contamination:

  • Use endotoxin-free reagents

  • Incorporate specific endotoxin removal steps

  • Consider polymyxin B columns or Triton X-114 extraction

Western blotting, as used with recombinant GRA proteins, can help identify expression and purification issues by revealing unexpected molecular weights or degradation products .

What analytical techniques are most effective for characterizing recombinant GRA4?

Several analytical techniques are essential for comprehensive characterization of recombinant GRA4:

  • SDS-PAGE: Provides information on molecular weight, purity, and integrity. Studies have confirmed that recombinant NcGRA4 shows a band at the expected molecular weight of 32 kDa .

  • Western blotting: Verifies the identity and antigenicity of the protein using specific antibodies. This technique has been successfully applied to recombinant dense granule proteins like GRA5 and can similarly be applied to GRA4.

  • Mass spectrometry: Confirms protein identity and can identify post-translational modifications or unexpected sequence variations.

  • Circular dichroism: Provides information about secondary structure elements.

  • Enzyme-linked immunosorbent assay (ELISA): Assesses the antigenic properties and can help determine if the recombinant protein maintains conformational epitopes.

  • Surface plasmon resonance (SPR): Measures binding kinetics and affinity to antibodies or other interaction partners.

  • Size-exclusion chromatography combined with multi-angle light scattering (SEC-MALS): Determines molecular weight and aggregation state in solution.

These techniques together provide a complete profile of the recombinant protein's physical, chemical, and immunological properties, ensuring its suitability for downstream applications.

How can researchers validate the immunological activity of recombinant GRA4?

Validating the immunological activity of recombinant GRA4 requires multiple complementary approaches:

  • Western blot analysis: Using sera from infected animals or humans to detect recognition of the recombinant protein. This confirms that the recombinant protein presents epitopes recognized by antibodies generated during natural infection .

  • Comparative ELISAs: Testing the recombinant protein alongside established diagnostic antigens or whole parasite lysates using well-characterized serum panels. The sensitivity and specificity of recombinant NcGRA4 iELISA were shown to be 71.6% and 86.3%, respectively, when compared with the indirect fluorescent antibody test (IFAT) .

  • Immunization studies: Evaluating the antibody response generated by immunizing animals with the recombinant protein.

  • T-cell activation assays: Measuring the ability of the protein to stimulate T-cell responses in vitro.

  • Cytokine profiling: Determining the cytokine response patterns elicited by the recombinant protein in immune cells.

  • Cross-reactivity testing: Assessing potential cross-reactivity with antibodies against related parasites to ensure specificity.

  • ROC curve analysis: Determining optimal cutoff values for diagnostic applications and calculating sensitivity and specificity.

These validation steps ensure that the recombinant protein maintains the key immunological properties of the native protein and can reliably be used in research and diagnostic applications.

What quality control parameters should be established for recombinant GRA4 preparations?

A comprehensive quality control (QC) program for recombinant GRA4 preparations should include:

  • Purity assessment: ≥95% purity by SDS-PAGE or HPLC, with clear documentation of remaining impurities.

  • Identity confirmation: Mass spectrometry peptide mapping and N-terminal sequencing to verify the correct amino acid sequence.

  • Endotoxin testing: Limulus Amebocyte Lysate (LAL) assay with established acceptable limits (<0.1 EU/μg protein for most research applications).

  • Immunoreactivity: Consistent performance in Western blot and ELISA with reference sera.

  • Stability indicators: Defined storage conditions with verification of activity retention over time.

  • Lot-to-lot consistency: Comparative analysis between production batches for molecular weight, antigenic properties, and purity.

  • Functional assays: Application-specific tests that verify the protein performs consistently in its intended use.

  • Host cell protein content: Evaluation of residual E. coli proteins, particularly important for immunological applications.

  • Aggregation analysis: Size-exclusion chromatography to determine monomer percentage and aggregation state.

  • pH and buffer composition: Verification that final formulation meets specifications.

For diagnostic applications, establishing concordance with gold standard tests is essential. For NcGRA4, comparisons with IFAT have been conducted, providing important benchmarks for quality control .

How does recombinant GRA4-based serology compare with other diagnostic methods for detecting Toxoplasma and Neospora infections?

Recombinant GRA4-based serological assays offer several advantages and limitations compared to other diagnostic methods:

Diagnostic MethodSensitivitySpecificityAdvantagesLimitations
rGRA4 ELISA71.6% (for NcGRA4) 86.3% (for NcGRA4) Standardizable reagent, Cost-effective, AutomatableMay miss early infections, Requires species-specific optimization
Whole parasite lysate ELISA80-95%80-90%Detects antibodies to multiple antigensBatch-to-batch variation, Potential cross-reactivity
IFATReference standardReference standardHigh specificity, Visual confirmationLabor-intensive, Subjective interpretation, Requires fluorescence microscope
PCR90-95%>95%Direct detection of parasite, Can detect acute infectionRequires parasite DNA, Technical expertise needed, Higher cost
Recombinant multi-antigen tests85-95%90-95%Combines benefits of multiple antigensMore complex to produce and standardize

The performance of recombinant GRA4 varies between parasite species and depends on the specific population being tested. For NcGRA4, studies have shown promising results with sensitivity and specificity comparable to established methods . Like other recombinant antigen-based tests, GRA4 assays are particularly valuable for standardized, large-scale screening programs where consistency and cost-effectiveness are important.

What are the critical factors affecting the sensitivity and specificity of GRA4-based diagnostic tests?

Multiple factors influence the diagnostic performance of GRA4-based tests:

  • Protein conformation and epitope presentation: The expression system and purification method can affect how epitopes are presented, potentially altering antibody recognition.

  • Antigen purity: Contaminating proteins can lead to false positive results, reducing specificity.

  • Test format optimization: Coating concentration, blocking agents, sample dilution, and detection systems all require optimization.

  • Cutoff determination: The statistical method used to establish positive/negative thresholds significantly impacts sensitivity and specificity calculations.

  • Reference population selection: The characteristics of positive and negative control populations influence performance metrics.

  • Timing of infection: Antibody levels vary throughout infection stages, potentially affecting test sensitivity.

  • Host species differences: Test performance may vary when applied to different host species due to variations in immune responses.

  • Cross-reactivity assessment: Thorough evaluation against antibodies to related organisms is essential to confirm specificity.

  • Sample quality: Hemolysis, lipemia, or bacterial contamination can interfere with test results.

  • Strain variation: Genetic differences between parasite strains may affect antigen recognition.

For NcGRA4, when compared with IFAT as a reference, the sensitivity and specificity were 71.6% and 86.3%, respectively , highlighting the importance of these factors in test development and validation.

How can recombinant GRA4 be integrated into multiplex diagnostic platforms?

Recombinant GRA4 can be effectively integrated into multiplex diagnostic platforms through several strategic approaches:

  • Protein microarrays: GRA4 can be spotted alongside other recombinant antigens on protein microarrays, allowing simultaneous detection of antibodies against multiple parasite proteins. This approach maximizes the information obtained from a single sample while minimizing sample volume requirements.

  • Multiplex bead-based assays: GRA4 can be coupled to distinct fluorescent microspheres for inclusion in Luminex or similar bead-based multiplex systems. These platforms allow quantitative detection of antibodies against dozens of antigens simultaneously.

  • Line blot assays: Similar to Western blots but formatted with multiple antigens applied as distinct lines on a membrane strip, these assays provide a semi-quantitative multi-antigen profile.

  • Protein chimeras: GRA4 epitopes can be combined with epitopes from other diagnostic antigens to create chimeric proteins that detect antibodies against multiple targets in a single reaction.

  • ELISA arrays: Modified 96-well formats where different antigens are coated in different wells in a systematic pattern for parallel testing.

For optimal integration, several considerations are important:

  • Cross-reactivity testing between component antigens

  • Harmonization of assay conditions for all included antigens

  • Validation of individual and combined performance metrics

  • Development of appropriate controls and standards

Combining GRA4 with other dense granule proteins (like GRA7, GRA14, or GRA15) and antigens from different parasite compartments can increase diagnostic sensitivity while maintaining specificity, particularly for distinguishing between acute and chronic infections .

How can gene editing techniques be applied to study GRA4 function in parasite biology?

Modern gene editing approaches provide powerful tools for investigating GRA4 function:

  • CRISPR-Cas9 knockouts: Similar to the approaches used for GRA7, GRA14, and GRA15 , CRISPR-Cas9 can be used to generate GRA4-deficient parasites. This involves designing guide RNAs targeting the GRA4 locus and introducing drug resistance cassettes for selection. PCR, Western blotting, and immunofluorescence assays can confirm successful gene deletion.

  • Conditional knockdown systems: For studying essential genes, tetracycline-regulated expression systems or auxin-inducible degron tags can be employed to control GRA4 expression or protein levels temporally.

  • Endogenous tagging: Adding epitope tags or fluorescent proteins to the endogenous GRA4 locus allows tracking of the protein's localization and dynamics without disrupting normal expression patterns.

  • Complementation studies: Reintroducing wild-type or mutated versions of GRA4 into knockout strains helps identify critical functional domains and residues.

  • Domain swapping: Replacing specific domains with corresponding regions from related proteins helps identify sequence-specific functions.

  • Site-directed mutagenesis: Introducing specific mutations can reveal the importance of particular amino acids or motifs in protein function.

  • Promoter replacement: Substituting the native promoter with regulatable promoters enables controlled expression studies.

These approaches allow researchers to investigate GRA4's role in parasite virulence, host-pathogen interactions, and intracellular survival. Similar genetic manipulation strategies have successfully revealed functions of other dense granule proteins, such as their roles in modulating host NFκB signaling .

What is known about the structural biology of GRA4 and how can structural studies advance our understanding?

Current structural knowledge of GRA4 is limited, but advanced structural biology techniques could significantly enhance our understanding:

Structural information would complement functional studies and could reveal mechanisms by which GRA4 contributes to the parasite's manipulation of host cells, similar to how understanding the structure-function relationships of other dense granule proteins has illuminated their roles in host-pathogen interactions .

How does GRA4 compare to other dense granule proteins in terms of evolutionary conservation, expression patterns, and functional roles?

GRA4 exhibits both similarities and differences compared to other dense granule proteins:

FeatureGRA4GRA7GRA14GRA15GRA5
Evolutionary conservationConserved in Toxoplasma and NeosporaHighly conserved across ApicomplexaModerate conservationVariable conservationConserved in Toxoplasma lineages
Expression timingConstitutiveConstitutiveConstitutiveStrain-dependentConstitutive
Secretion regulationCalcium-dependent negative regulation Calcium-dependent negative regulation Calcium-dependent negative regulation Similar to other GRAsNot fully characterized
Host cell targetingPV membranePV membrane, host cytoplasmPV membraneHost nucleusPV membrane
Role in immune modulationModerateStrong - NFκB activation Moderate - NFκB activation Strong - NFκB activation Specific for toxoplasmosis diagnosis
Diagnostic valueHigh for neosporosis VariableModerateNot establishedHigh for toxoplasmosis
Knockout phenotypeNot fully characterizedIncreased replication in vitro Similar to wild-type Not fully characterizedNot fully characterized

The secretion of GRA proteins occurs within minutes of invasion and continues during intracellular development. This secretion appears to be negatively regulated by calcium , a mechanism that likely applies to GRA4 as well, though specific studies focusing on GRA4 secretion regulation are needed.

How does recombinant GRA4 induce immune responses and what are the implications for vaccine development?

Recombinant GRA4 stimulates multiple arms of the immune system, making it a candidate for vaccine development:

  • Humoral immunity: GRA4 elicits strong antibody responses, as evidenced by its effectiveness as a diagnostic antigen in ELISA and Western blot assays . These antibodies may contribute to protection by:

    • Preventing parasite attachment to host cells

    • Facilitating complement-mediated lysis of extracellular parasites

    • Enhancing phagocytosis through opsonization

    • Potentially neutralizing the function of secreted GRA4

  • Cell-mediated immunity: Like other dense granule proteins, GRA4 likely triggers T-cell responses, which are crucial for controlling intracellular parasites through:

    • CD4+ T-cell production of IFN-γ, which activates macrophages

    • CD8+ T-cell recognition and elimination of infected cells

    • Cytokine-mediated enhancement of intracellular killing mechanisms

  • Innate immune activation: GRA proteins have been shown to modulate NFκB signaling , suggesting recombinant GRA4 may also stimulate innate immune pathways.

For vaccine development, these considerations are relevant:

  • Adjuvant selection should enhance both humoral and cell-mediated responses

  • Delivery systems that promote cross-presentation for CD8+ T-cell activation may be beneficial

  • Combination with other immunogenic antigens might broaden protection

  • Species-specific differences in immune recognition must be considered

  • Stability and formulation must maintain critical epitopes

The immunogenicity profile of recombinant GRA4 makes it a promising component for subunit vaccine approaches, potentially contributing to protective immunity against toxoplasmosis or neosporosis when appropriately formulated and delivered.

What are the challenges in differentiating between vaccine-induced immunity and natural infection when using GRA4 as a diagnostic target?

Distinguishing vaccine-induced immunity from natural infection presents several challenges when GRA4 serves as both a vaccine component and diagnostic target:

  • Serological interference: Vaccination with GRA4-containing formulations generates antibodies indistinguishable from those produced during natural infection in conventional serological tests, potentially resulting in false-positive diagnostic outcomes.

  • Limited differential markers: The immune response to GRA4 alone may not provide sufficient information to distinguish vaccination from infection status.

  • Timing challenges: Antibody kinetics following vaccination versus natural infection may differ initially but converge over time, complicating interpretation.

  • Host variability: Individual immune responses to both vaccination and infection vary, creating overlapping serological profiles.

Potential solutions include:

  • DIVA (Differentiating Infected from Vaccinated Animals) approaches:

    • Using tagged recombinant GRA4 in vaccines that contain epitopes not present in natural infections

    • Combining GRA4 with unique carrier proteins that elicit detectable antibody responses

    • Excluding certain immunodominant epitopes from vaccine constructs

  • Complementary diagnostic strategies:

    • Monitoring antibodies against parasite proteins not included in the vaccine

    • Utilizing cellular immunity assays that may show different profiles

    • PCR-based detection of parasite DNA would indicate active infection

  • Alternative testing paradigms:

    • Measuring antibody affinity maturation patterns

    • Evaluating IgG subclass distributions

    • Assessing cytokine profiles

This challenge underscores the importance of integrated approaches to vaccine and diagnostic development, particularly when recombinant antigens serve dual purposes in disease management strategies.

How do post-translational modifications affect the immunogenicity and diagnostic utility of recombinant GRA4?

Post-translational modifications (PTMs) significantly impact both the immunogenicity and diagnostic performance of recombinant GRA4:

  • Types of PTMs potentially present in native GRA4:

    • Glycosylation (N-linked and O-linked)

    • Phosphorylation

    • Proteolytic processing

    • Disulfide bond formation

    • Lipid modifications

  • Impact on immunogenicity:

    • PTMs can create or mask immunodominant epitopes

    • Glycosylation patterns influence antigen processing and presentation

    • Conformational epitopes dependent on disulfide bonds may be lost in recombinant systems

    • Modified residues may themselves serve as antigenic determinants

  • Consequences for diagnostic applications:

    • Recombinant GRA4 expressed in E. coli lacks eukaryotic PTMs, potentially reducing sensitivity

    • Antibodies specifically targeting glycan structures on native GRA4 won't recognize bacterial recombinant versions

    • Conformational epitopes dependent on proper disulfide formation may be absent

    • Improper folding can expose normally hidden epitopes, potentially causing false positives

  • Strategies to address PTM-related issues:

    • Expression in eukaryotic systems (yeast, insect cells, mammalian cells) to incorporate relevant PTMs

    • Chemical or enzymatic addition of specific modifications post-purification

    • Computational prediction and site-directed mutagenesis to eliminate non-essential PTM sites

    • Selection of epitopes not affected by PTMs for diagnostic applications

  • Experimental assessment approaches:

    • Comparative serological testing with native and recombinant proteins

    • Mass spectrometry analysis to identify and map PTMs

    • Glycan analysis using lectins or specific glycosidases

    • Immunodepletion studies with differentially modified antigens

While recombinant NcGRA4 expressed in E. coli has shown promising diagnostic utility with sensitivity of 71.6% and specificity of 86.3% , further improvements might be possible by addressing PTM-related issues, potentially enhancing both sensitivity and specificity for detecting Neospora infections.

What innovative approaches could enhance the expression, purification, and stability of recombinant GRA4?

Several innovative strategies could advance recombinant GRA4 production and quality:

  • Expression system innovations:

    • Cell-free protein synthesis for rapid production and reduced endotoxin

    • Synthetic biology approaches with optimized genetic circuits for controlled expression

    • Plant-based expression systems for cost-effective scale-up and proper glycosylation

    • Thermostable bacterial hosts for expression at elevated temperatures to prevent aggregation

  • Protein engineering strategies:

    • Computational design of stabilizing mutations based on molecular dynamics simulations

    • Directed evolution to select for variants with enhanced expression and stability

    • Fusion to novel stability-enhancing partners beyond traditional tags

    • Circular permutation to optimize folding pathways

  • Advanced purification technologies:

    • Continuous chromatography systems for improved efficiency and consistency

    • Membrane-based separation techniques for gentler processing

    • Stimuli-responsive smart polymers for simplified purification

    • Single-step affinity/ion exchange hybrid matrices

  • Stability enhancement approaches:

    • Rational design of disulfide bonds for conformational stabilization

    • Formulation with novel excipients derived from extremophile organisms

    • Spray-freeze drying for room-temperature stable preparations

    • Encapsulation in nanoparticles or liposomes for protection against degradation

  • Quality control advancements:

    • Real-time monitoring of protein folding during expression using fluorescent reporters

    • Application of hydrogen-deuterium exchange mass spectrometry for detailed stability profiling

    • Machine learning algorithms to predict optimal expression and purification conditions

    • Implementation of process analytical technology (PAT) for continuous quality assessment

These approaches could address current limitations in producing high-quality recombinant GRA4, potentially improving yields, reducing costs, and enhancing the consistency and performance of derived diagnostic tools or vaccine components.

How might systems biology approaches enhance our understanding of GRA4's role in host-pathogen interactions?

Systems biology offers powerful frameworks to unravel GRA4's role in host-pathogen dynamics:

  • Multi-omics integration approaches:

    • Combining transcriptomics, proteomics, and metabolomics data from GRA4-knockout versus wild-type parasites

    • Temporal profiling of host cell responses to purified recombinant GRA4

    • Phosphoproteomics to identify signaling pathways modulated by GRA4

    • Spatial proteomics to map GRA4 interactome within different subcellular compartments

  • Network analysis methods:

    • Construction of protein-protein interaction networks centered on GRA4

    • Pathway enrichment analysis to identify processes affected by GRA4

    • Identification of key network nodes that mediate GRA4's effects on host cells

    • Comparison with networks affected by other GRA proteins like GRA7, GRA14, and GRA15

  • Mathematical modeling approaches:

    • Ordinary differential equation models of signaling dynamics influenced by GRA4

    • Agent-based models of host-parasite interactions incorporating GRA4 functions

    • Flux balance analysis to understand metabolic consequences of GRA4 activity

    • Machine learning to identify patterns in host response data

  • Single-cell technologies:

    • scRNA-seq to characterize heterogeneity in host cell responses to GRA4

    • Mass cytometry to profile immune cell activation patterns

    • Digital spatial profiling to map GRA4 effects within infected tissues

    • Live-cell imaging with fluorescent reporters to track signaling dynamics

  • Comparative systems approaches:

    • Cross-species analysis of GRA4 function in different host cell types

    • Evolutionary analysis of GRA4 across parasite strains with different virulence profiles

    • Comparison of systems-level effects between GRA4 and other secreted effectors

Such approaches could reveal how GRA4 fits into the broader picture of host manipulation by parasites. RNA-seq analysis has already provided insights into how GRA proteins like GRA7, GRA14, and GRA15 influence host gene expression through NFκB signaling , and similar approaches could illuminate GRA4's role in host-pathogen interactions.

What potential exists for GRA4-based therapies or interventions beyond diagnostics and vaccines?

Exploring GRA4 beyond diagnostics and vaccines reveals several innovative therapeutic possibilities:

  • Targeted drug delivery systems:

    • GRA4-based peptides as targeting moieties for nanoparticles containing antiparasitic drugs

    • Exploitation of GRA4's natural trafficking mechanisms to deliver compounds to parasite-containing vacuoles

    • Development of antibody-drug conjugates targeting GRA4 epitopes exposed during infection

  • Immunomodulatory applications:

    • Engineering GRA4 variants that selectively activate protective immune pathways

    • Developing GRA4-based antagonists that block immunopathological responses

    • Creating chimeric proteins combining GRA4 epitopes with immunomodulatory domains

  • Anti-adhesion strategies:

    • If GRA4 participates in host cell attachment, developing peptide mimetics to block this interaction

    • Designing small molecule inhibitors targeting GRA4 functional domains

    • Creating decoy receptors based on GRA4-binding partners

  • Diagnostic imaging:

    • Radiolabeled anti-GRA4 antibodies for parasite localization in vivo

    • GRA4-targeted contrast agents for enhanced imaging of infection sites

    • Theranostic approaches combining imaging and therapeutic capabilities

  • Biotechnological applications:

    • Adapting GRA4's properties for protein delivery systems in non-parasitological contexts

    • Using GRA4's secretion signals to engineer novel protein secretion platforms

    • Developing GRA4-based biosensors for detecting specific cellular conditions

  • Structure-based drug design:

    • Once GRA4's structure is determined, rational design of inhibitors targeting critical functional sites

    • Fragment-based drug discovery approaches using structural data

    • Virtual screening campaigns against the GRA4 structure to identify lead compounds

While many of these applications remain theoretical, they highlight the untapped potential of GRA4 beyond conventional applications. Similar approaches exploring other dense granule proteins have shown promise, suggesting parallel opportunities for GRA4-based interventions.

What experimental protocols have proven most effective for evaluating recombinant GRA4 in serological assays?

Based on published research with recombinant dense granule proteins, the following optimized protocols have proven most effective:

For indirect ELISA (iELISA):

  • Antigen coating:

    • Optimal concentration: 1-5 μg/ml recombinant GRA4 in carbonate-bicarbonate buffer (pH 9.6)

    • Incubation: Overnight at 4°C in high-binding microplates

    • Blocking: 2-3% BSA or 5% non-fat dry milk in PBS-T for 1-2 hours at 37°C

  • Sample preparation and application:

    • Serum dilution: 1:100 to 1:200 in blocking buffer

    • Incubation: 1 hour at 37°C with gentle shaking

    • Washing: 4-5 times with PBS-T using an automated washer

  • Secondary antibody:

    • Species-appropriate HRP-conjugated antibody at 1:5,000-1:10,000 dilution

    • Incubation: 1 hour at 37°C

    • Development: TMB substrate for 10-15 minutes, stopped with H₂SO₄

  • Analysis:

    • Measure absorbance at 450 nm

    • Calculate cutoff values using ROC curve analysis or mean plus 3 standard deviations of negative controls

For Western blot analysis:

  • Electrophoresis:

    • Load 1-2 μg purified recombinant GRA4 per lane

    • Run on 12% SDS-PAGE at 100V until tracking dye reaches bottom

  • Transfer:

    • Semi-dry or wet transfer to PVDF membrane

    • Transfer conditions: 100V for 1 hour or 30V overnight at 4°C

  • Immunodetection:

    • Blocking: 5% non-fat dry milk in TBS-T for 1-2 hours

    • Primary antibody: Serum samples diluted 1:100-1:500, overnight at 4°C

    • Secondary antibody: HRP-conjugated antibody at 1:5,000-1:10,000, 1 hour at room temperature

    • Development: Enhanced chemiluminescence detection

These protocols have been successfully applied to other recombinant dense granule proteins, including NcGRA4 and TgGRA5, yielding reliable serological results with high sensitivity and specificity .

What are the best approaches for studying GRA4 trafficking and secretion in live parasites?

Advanced imaging and molecular approaches offer powerful tools for studying GRA4 trafficking and secretion:

  • Fluorescent protein tagging strategies:

    • Endogenous tagging with mNeonGreen or mScarlet using CRISPR-Cas9

    • Generation of parasite lines expressing GRA4-HaloTag for pulse-chase experiments

    • Split fluorescent protein complementation to visualize interactions during trafficking

    • pH-sensitive fluorescent tags to monitor environmental changes during secretion

  • Live-cell imaging techniques:

    • Spinning disk confocal microscopy for rapid acquisition with minimal phototoxicity

    • Total internal reflection fluorescence (TIRF) microscopy to visualize events near the parasite membrane

    • Light sheet microscopy for extended 3D imaging with reduced photodamage

    • Super-resolution approaches (STED, PALM/STORM) for nanoscale visualization of trafficking events

  • Trafficking pathway investigation:

    • Pharmacological inhibitors of specific trafficking components (e.g., Brefeldin A for Golgi-ER transport)

    • Co-expression with fluorescently tagged organelle markers

    • Temperature blocks to synchronize trafficking events

    • Correlative light and electron microscopy (CLEM) for ultrastructural context

  • Secretion dynamics studies:

    • Calcium uncaging with photosensitive chelators to examine calcium regulation of secretion

    • Microfluidic systems for precise control of parasite environment during imaging

    • Quantitative analysis of secretion using flow cytometry or automated image analysis

    • Optogenetic manipulation of potential secretion regulatory pathways

  • Biochemical approaches:

    • Pulse-chase radiolabeling to track protein movement through compartments

    • Subcellular fractionation to isolate trafficking intermediates

    • Proximity labeling (BioID or APEX) to identify neighboring proteins during transit

    • Synchronized invasion assays to capture specific secretion timepoints

These approaches could help address fundamental questions about GRA4 secretion, including whether it follows the calcium-dependent negative regulation observed for other dense granule proteins and how its trafficking pathway compares to other secretory proteins in apicomplexan parasites.

How can researchers effectively compare the performance of different recombinant GRA4 constructs in research and diagnostic applications?

Systematic comparative evaluation of recombinant GRA4 constructs requires standardized methodologies:

  • Experimental design considerations:

    • Design factorial experiments examining multiple variables simultaneously

    • Include standardized positive and negative controls across all experiments

    • Perform power analysis to determine appropriate sample sizes

    • Use paired statistical tests when comparing constructs with the same samples

    • Implement blinded assessment when subjective measurements are involved

  • Expression and purification comparison:

    • Quantify yield at each purification step under standardized conditions

    • Assess purity using densitometry of SDS-PAGE gels

    • Determine specific activity per unit protein

    • Evaluate endotoxin levels using standardized LAL assays

    • Measure aggregation propensity using dynamic light scattering

  • Structural and stability assessment:

    • Conduct differential scanning calorimetry to determine thermal stability

    • Compare secondary structure content using circular dichroism

    • Assess long-term stability under identical storage conditions

    • Evaluate resistance to proteolytic degradation

    • Measure binding kinetics to specific antibodies using surface plasmon resonance

  • Diagnostic performance evaluation:

    • Calculate sensitivity, specificity, and area under ROC curve using identical serum panels

    • Determine concordance with reference methods using weighted kappa statistics

    • Assess reproducibility through intra- and inter-assay coefficient of variation

    • Evaluate lot-to-lot consistency in diagnostic performance

    • Perform head-to-head comparisons using serum samples representing different infection stages

  • Reporting standards:

    • Document exact construct sequences including tags and linkers

    • Provide detailed methodological descriptions enabling reproduction

    • Present raw data alongside processed results

    • Use appropriate statistical methods with correction for multiple comparisons

    • Follow STARD guidelines for diagnostic test evaluation studies

This systematic approach has been used to evaluate other dense granule proteins such as NcGRA4, which demonstrated sensitivity of 71.6% and specificity of 86.3% compared to IFAT , and TgGRA5, which showed 100% specificity for toxoplasmosis-negative human sera .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.