Recombinant Toxoplasma gondii Dense granule protein 7 (GRA7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Toxoplasma gondii Dense Granule Protein 7 (GRA7)

Recombinant Toxoplasma gondii Dense Granule Protein 7 (GRA7) is a protein derived from the protozoan parasite Toxoplasma gondii, which is an obligate intracellular pathogen affecting a wide range of warm-blooded animals, including humans. GRA7 is one of several dense granule proteins secreted by T. gondii during its lifecycle, playing crucial roles in the modification of the parasitophorous vacuole and interaction with host cells .

Structure and Function

GRA7 is expressed as a recombinant protein in Escherichia coli, often with additional sequences like histidine tags for purification purposes . The recombinant form corresponding to amino acids 24-100 of GRA7 is commonly used in research . GRA7 forms large complexes with other dense granule proteins, facilitating the secretion of transmembrane domain-containing proteins . It is phosphorylated only in the presence of host cells and associates with rhoptry proteins such as ROP2 and ROP4 .

Diagnostic and Immunological Significance

GRA7 is highly antigenic and has been evaluated for its potential in diagnosing T. gondii infections. In enzyme-linked immunosorbent assays (ELISAs), recombinant GRA7 shows a sensitivity of 81% for detecting IgG antibodies in human sera, with higher sensitivity (94%) in acute-phase sera . When combined with other antigens like Tg34AR, the sensitivity can increase to 96% .

AntigenSensitivity in Chronic PhaseSensitivity in Acute PhaseCombined Sensitivity
GRA779%94%-
GRA7 + Tg34AR--96%

Research Findings and Applications

GRA7 has been studied for its role in immune modulation and potential as a vaccine candidate. It interacts with host cell proteins, influencing the NF-κB pathway and promoting an inflammatory response . The protein's ability to induce strong antibody responses makes it a valuable tool for studying the immune response to T. gondii .

Interaction with Host Immune Pathways

GRA7 associates with rhoptry proteins and is involved in the activation of the NF-κB pathway, although its role is less pronounced compared to other dense granule proteins like GRA15 . It also interacts with inflammasome-related molecules, contributing to innate immune responses .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to concentrate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
GRA7; Dense granule protein 7; Protein GRA 7; 29 kDa excretory dense granule protein; p29
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-236
Protein Length
Full Length of Mature Protein
Species
Toxoplasma gondii
Target Names
GRA7
Target Protein Sequence
ATASDDELMSRIRNSDFFDGQAPVDSLRPTNAGVDSKGTDDHLTTSMDKASVESQLPRRE PLETEPDEQEEVHFRKRGVRSDAEVTDDNIYEEHTDRKVVPRKSEGKRSFKDLLKKLALP AVGMGASYFAADRLVPELTEEQQRGDEPLTTGQNVGTVLGFAALAAAAAFLGMGLTRTYR HFSPRKNRSRQPALEQEVPESGEDGEDARQ
Uniprot No.

Target Background

Protein Families
Gra7 family
Subcellular Location
Secreted. Parasitophorous vacuole lumen. Parasitophorous vacuole membrane. Cytoplasmic vesicle, secretory vesicle. Note=Located in dense granules of tachyzoites. Upon infection, secreted into the parasitophorous vacuole (PV).

Q&A

What is Toxoplasma gondii GRA7 and what is its significance in parasite biology?

Toxoplasma gondii GRA7 is a dense granule protein secreted by the obligate intracellular parasite T. gondii. It plays significant roles in host-parasite interactions and is secreted from both bradyzoites and tachyzoites. GRA7 is particularly noteworthy for its involvement in the formation of the parasitophorous vacuole (PV) membrane. This protein is not only found within the PV but is also secreted into the host cell cytosol shortly after invasion, where it forms distinctive strand-like structures containing other parasite proteins. The significance of GRA7 lies in its dual role: participating in the structural organization of the parasitophorous vacuole and potentially modulating host cell responses during infection . Its detection in the host cytosol within 10 minutes of invasion suggests a rapid and important function in the early stages of infection establishment .

What are the methods for confirming the structural integrity of recombinant GRA7?

When working with recombinant GRA7, confirming structural integrity is essential to ensure functionality in downstream applications. Recommended methods include:

  • SDS-PAGE and Western blotting: Verifies the molecular weight and immunoreactivity of the recombinant protein

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure elements

  • Mass spectrometry: Confirms the amino acid sequence and identifies any post-translational modifications

  • Size exclusion chromatography: Evaluates the oligomeric state and potential aggregation

  • Functional assays: Tests the ability of recombinant GRA7 to interact with known binding partners such as ROP2 and ROP4

These complementary approaches provide comprehensive validation of recombinant GRA7 structural integrity before experimental use.

What are the optimal conditions for recombinant GRA7 expression in bacterial systems?

For the successful expression of recombinant GRA7 in bacterial systems, the following protocol has been successfully employed:

  • Vector selection: pMAL-p2X vector with maltose-binding protein (MBP) fusion tag has proven effective for GRA7 expression

  • Bacterial strain: E. coli strains optimized for high transformation efficiency and plasmid propagation are ideal

  • Cloning strategy:

    • PCR amplification of GRA7 from genomic DNA using primers that include appropriate restriction sites (e.g., BamHI and PstI)

    • Ligation into expression vector in-frame with a fusion tag like MBP

    • Confirmation via diagnostic restriction digests

  • Expression conditions:

    • Induction with IPTG (typically 0.1-0.5 mM)

    • Growth temperature of 16-25°C post-induction to enhance solubility

    • Incubation time of 3-16 hours depending on protein stability

This approach can yield functionally active recombinant GRA7 suitable for immunological and biochemical studies .

What purification strategies yield highest purity recombinant GRA7?

A multi-step purification strategy is recommended for obtaining high-purity recombinant GRA7:

  • Initial affinity chromatography:

    • For MBP-tagged GRA7, amylose resin affinity purification

    • For His-tagged constructs, immobilized metal affinity chromatography (IMAC)

  • Secondary purification steps:

    • Ion-exchange chromatography to separate based on charge differences

    • Size-exclusion chromatography to remove aggregates and achieve higher homogeneity

  • Tag removal considerations:

    • Enzymatic cleavage of fusion tags using specific proteases (e.g., Factor Xa for MBP tag)

    • Second affinity step to separate cleaved tag from target protein

  • Quality control:

    • SDS-PAGE to assess purity (aim for >95%)

    • Western blot to confirm identity

    • Activity assays to ensure functionality is maintained after purification

This systematic approach can yield highly pure recombinant GRA7 suitable for structural studies, immunological assays, and interaction analyses.

How effective is recombinant GRA7 in ELISA-based diagnosis of toxoplasmosis?

Recombinant GRA7 has demonstrated considerable efficacy in ELISA-based diagnosis of toxoplasmosis. Studies show that ELISA using recombinant GRA7 exhibits a significantly higher sensitivity to sera from humans with IgM-positive status compared to those with IgG-positive status . This makes it particularly valuable for detecting acute infections. The performance characteristics of rGRA7-based ELISA include:

Performance ParameterAcute Toxoplasmosis (IgM+)Chronic Toxoplasmosis (IgG+)
SensitivityHighModerate
SpecificityHighHigh
Positive Predictive ValueHighModerate
Negative Predictive ValueHighModerate

This differential sensitivity makes rGRA7-based ELISA particularly useful for diagnosing acute toxoplasmosis, addressing a critical need in clinical settings where distinguishing between acute and chronic infections impacts treatment decisions .

How does GRA7 compare with other T. gondii antigens for serodiagnosis?

When comparing GRA7 with other T. gondii antigens for serodiagnosis, several distinctive patterns emerge:

  • Acute infection detection: GRA7 shows superior sensitivity for acute infection detection compared to many other antigens, making it particularly valuable for identifying recent infections

  • Antigen comparison table:

AntigenAcute Infection (IgM) SensitivityChronic Infection (IgG) SensitivitySpecificityNotable Characteristics
GRA7HighModerateHighEarly detection capability; strand-like structures in host cytosol
SAG1ModerateHighVery HighSurface antigen; highly conserved
GRA1ModerateModerateHighCo-localizes with GRA7 in strands
GRA3ModerateModerateHighCo-localizes with GRA7 in strands
ROP2VariableModerateHighAssociates with GRA7 independent of phosphorylation

This comparative analysis highlights GRA7's distinctive value in diagnostic applications, particularly for acute infection detection.

What protein-protein interactions does GRA7 form during infection?

GRA7 engages in multiple protein-protein interactions during T. gondii infection, making it a crucial node in the parasite's interaction network:

  • Interactions with rhoptry proteins:

    • GRA7 associates with ROP2 and ROP4 in infected host cells

    • This association occurs independently of GRA7's phosphorylation state

    • These interactions represent the first documented case of proteins secreted from rhoptries (ROPs) interacting with dense granule proteins (GRAs)

  • Interactions with other dense granule proteins:

    • GRA7 strands in the host cytosol also contain GRA1 and GRA3

    • These co-localizations suggest functional cooperation between different GRA proteins

  • Temporal dynamics of interactions:

    • Within 10 minutes of invasion, GRA7 forms strand-like structures in the host cytosol

    • These strands contain rhoptry proteins, indicating rapid deployment and interaction after invasion

These diverse interactions suggest GRA7 functions as a molecular scaffold or adaptor that coordinates the activities of multiple parasite effector proteins during infection .

How can researchers experimentally map the interactome of recombinant GRA7?

To experimentally map the GRA7 interactome, researchers should consider a comprehensive multi-method approach:

  • Co-immunoprecipitation (Co-IP) strategies:

    • Express tagged recombinant GRA7 in parasite cells or host cells

    • Immunoprecipitate GRA7 complexes using tag-specific antibodies

    • Identify interacting partners via mass spectrometry

    • Validate with reciprocal Co-IP experiments

  • Proximity-based labeling methods:

    • Create GRA7 fusions with proximity labeling enzymes (BioID, APEX)

    • Express in appropriate cellular contexts

    • Identify proximal proteins via streptavidin pulldown and mass spectrometry

  • Yeast two-hybrid screening:

    • Use GRA7 as bait against T. gondii cDNA libraries and/or host cell libraries

    • Follow up positive interactions with validation in mammalian systems

  • Cross-linking mass spectrometry (XL-MS):

    • Apply protein cross-linkers to stabilize transient interactions

    • Digest and analyze via mass spectrometry to identify cross-linked peptides

    • Infer direct protein-protein interactions and contact sites

  • Experimental design considerations:

    • Compare interactomes between different parasite strains

    • Assess how phosphorylation affects interaction patterns

    • Examine temporal dynamics of interactions during infection progression

This systematic approach can reveal both expected partners (e.g., ROP2, ROP4, GRA1, GRA3) and potentially novel interactors that expand our understanding of GRA7 function during infection .

What approaches can be used to study the role of GRA7 phosphorylation?

To investigate the functional significance of GRA7 phosphorylation, researchers should consider the following experimental approaches:

  • Phosphosite mapping:

    • Use mass spectrometry to identify specific phosphorylation sites in GRA7

    • Compare phosphorylation patterns between different parasite strains and infection stages

  • Phosphomimetic and phosphodeficient mutants:

    • Generate recombinant GRA7 variants with mutations at identified phosphosites:

      • Phosphomimetic (S/T→D/E) to simulate constitutive phosphorylation

      • Phosphodeficient (S/T→A) to prevent phosphorylation

    • Express these mutants in parasites using CRISPR/Cas9 genome editing

  • Kinase identification:

    • Perform kinase inhibitor screens to identify candidate kinases

    • Use in vitro kinase assays with recombinant GRA7 and purified kinases

    • Apply phosphoproteomics to trace kinase-substrate relationships

  • Functional readouts to assess phosphorylation effects:

    • Parasite invasion and replication rates

    • Host cell signaling responses

    • Protein-protein interaction profiles

    • Subcellular localization of GRA7

  • Temporal analysis:

    • Examine phosphorylation dynamics during the course of infection

    • Correlate phosphorylation events with specific stages of the parasite life cycle

This multi-faceted approach can reveal how phosphorylation regulates GRA7 function, potentially controlling its interactions, localization, and biological activities during infection .

How does recombinant GRA7 modulate host immune responses?

Recombinant GRA7 has significant immunomodulatory properties that affect host responses to T. gondii infection:

  • Antibody response patterns:

    • GRA7 elicits strong antibody responses during both acute and chronic infection phases

    • Certain epitopes presented by GRA7 are particularly immunogenic during acute toxoplasmosis

    • The observed higher sensitivity of rGRA7-ELISA for IgM positive sera supports its role in early immune response

  • Cytokine induction:

    • Recombinant GRA7 can stimulate production of pro-inflammatory cytokines

    • This may contribute to protective immunity but also to immunopathology

  • Cellular immune responses:

    • GRA7 contains epitopes recognized by CD4+ and CD8+ T cells

    • These T cell responses are critical for long-term control of infection

  • Experimental design for immune studies:

    • Use purified recombinant GRA7 for in vitro stimulation of immune cells

    • Compare responses between cells from naïve individuals and toxoplasmosis patients

    • Assess cytokine profiles, cell activation markers, and proliferative responses

Understanding these immunomodulatory properties has significant implications for both diagnostic development and vaccine design strategies targeting toxoplasmosis .

What experimental design approaches are most suitable for studying GRA7 functions?

When designing experiments to investigate GRA7 functions, researchers should consider structured approaches borrowed from design of experiments (DOE) methodology:

  • Factorial experimental design:

    • Systematically vary multiple factors affecting GRA7 function

    • Assess interaction effects between variables

    • Examples of factors to consider:

      • Parasite strain variations

      • Host cell types

      • Infection duration

      • MOI (multiplicity of infection)

  • Response surface methodology:

    • Optimize experimental conditions for specific GRA7-related outcomes

    • Use standard designs for second-order models to map relationships

    • Apply response surface split-plot designs for complex experimental setups

  • Crossover designs:

    • Particularly useful for studying temporal effects of GRA7

    • Enable isolation of time-dependent effects from other variables

    • Allow for efficient use of experimental resources

  • Blocking strategies:

    • Control for batch effects in protein preparation

    • Account for variability in cell cultures

    • Ensure statistical power while minimizing systematic biases

  • Sample size determination:

    • Calculate required replicates based on expected effect sizes

    • Perform power analysis before experimentation

    • Balance statistical rigor with practical constraints

This structured approach to experimental design can help researchers obtain more reliable and interpretable results when studying the complex functions of GRA7 in host-parasite interactions .

What are common challenges when working with recombinant GRA7 and how can they be addressed?

Researchers working with recombinant GRA7 often encounter several challenges that can be systematically addressed:

  • Protein solubility issues:

    • Challenge: Recombinant GRA7 may form inclusion bodies in bacterial expression systems

    • Solutions:

      • Use solubility-enhancing fusion tags (MBP, SUMO, GST)

      • Lower expression temperature (16-20°C)

      • Co-express with molecular chaperones

      • Optimize buffer conditions (pH, salt concentration, additives)

  • Maintaining native conformations:

    • Challenge: Recombinant protein may not fold correctly or maintain functional epitopes

    • Solutions:

      • Consider eukaryotic expression systems closer to native environment

      • Carefully optimize purification conditions to preserve structure

      • Validate activity through functional assays

  • Reproducing post-translational modifications:

    • Challenge: Bacterial systems cannot reproduce the phosphorylation observed in host cells

    • Solutions:

      • Use mammalian or insect cell expression systems

      • Consider in vitro phosphorylation with relevant kinases

      • Compare results between differently modified versions

  • Aggregation during storage:

    • Challenge: Purified GRA7 may aggregate over time

    • Solutions:

      • Add stabilizing agents (glycerol, specific ions)

      • Optimize storage conditions (temperature, concentration)

      • Aliquot and minimize freeze-thaw cycles

  • Variability between preparations:

    • Challenge: Batch-to-batch variability affects experimental reproducibility

    • Solutions:

      • Implement stringent quality control measures

      • Characterize each batch thoroughly

      • Use internal standards and reference preparations

These practical approaches can help researchers overcome technical challenges and produce reliable, functional recombinant GRA7 for their studies .

What are promising future applications for recombinant GRA7 in toxoplasmosis research?

Several promising research directions for recombinant GRA7 warrant further investigation:

  • Development of next-generation diagnostics:

    • Multi-epitope GRA7 constructs for improved sensitivity

    • Point-of-care rapid tests incorporating GRA7

    • Combined GRA7/ROP antigen panels for stage-specific diagnosis

  • Vaccine development:

    • GRA7 as a component in subunit vaccine formulations

    • Evaluation of GRA7 epitopes for protective immunity

    • Delivery systems optimized for GRA7 presentation to the immune system

  • Host-pathogen interaction studies:

    • Detailed mapping of GRA7 interactome in different host cell types

    • Temporal dynamics of GRA7 deployment during infection

    • Mechanisms by which GRA7 traverses the parasitophorous vacuole membrane

  • Structural biology approaches:

    • High-resolution structures of GRA7 in different phosphorylation states

    • Co-crystal structures with known binding partners (ROPs, other GRAs)

    • Structure-guided development of inhibitors targeting GRA7 functions

  • Therapeutic target potential:

    • Assessment of GRA7's essentiality for parasite survival

    • Identification of druggable pockets or interfaces

    • Development of inhibitors targeting critical GRA7 interactions

These research directions leverage the unique properties of GRA7, particularly its dual localization in the parasitophorous vacuole and host cytosol, and its interactions with both parasite and potentially host proteins .

How can researchers apply for funding to study recombinant GRA7 in toxoplasmosis?

Researchers seeking funding for GRA7-focused toxoplasmosis research should consider the following funding strategies:

  • European Research Council (ERC) Advanced Grants:

    • Suitable for established investigators with track records of significant achievements

    • Supports ground-breaking, ambitious projects in any field of research

    • Operates on a "bottom-up" basis without predetermined priorities

    • Research must be conducted in a public or private research organization in EU Member States or associated countries

    • Supports individual researchers who can employ team members of any nationality

  • Key elements for successful applications:

    • Emphasize the originality and significance of GRA7 research

    • Highlight the innovative aspects of the proposed methodology

    • Clearly articulate the potential impact on toxoplasmosis diagnosis or treatment

    • Demonstrate feasibility through preliminary data

    • Assemble a team with complementary expertise

  • Application process considerations:

    • Applications require a single Principal Investigator to submit on behalf of their host institution

    • The host institution must offer suitable conditions for independent research

    • The PI doesn't need to be employed by the host institution at the time of proposal submission, but a mutual agreement and commitment are necessary if successful

  • Alternative funding sources:

    • National research councils in respective countries

    • Disease-specific foundations focused on parasitic diseases

    • Public-private partnerships with diagnostic companies

    • International collaborations with endemic-region institutions

This structured approach to funding applications can increase the chances of securing resources for innovative GRA7 research projects .

What are the best practices for validating recombinant GRA7 for research applications?

To ensure high-quality research outcomes when working with recombinant GRA7, researchers should implement these validation best practices:

  • Authentication protocols:

    • Sequence verification of expression constructs

    • Mass spectrometry confirmation of protein identity

    • Immunoreactivity testing with specific anti-GRA7 antibodies

    • Functional tests based on known GRA7 properties

  • Quality control metrics:

    • Purity assessment (>95% by SDS-PAGE)

    • Endotoxin testing for immunological applications

    • Batch-to-batch consistency evaluation

    • Stability monitoring during storage

  • Functional validation:

    • Verification of protein-protein interactions with known partners (ROPs, other GRAs)

    • Confirmation of immunological properties in serological assays

    • Assessment of phosphorylation status if relevant to the application

  • Documentation standards:

    • Detailed records of expression conditions

    • Complete purification protocols

    • Thorough characterization data

    • Clear reporting of validation results in publications

Implementing these validation practices ensures reliable, reproducible research with recombinant GRA7 and facilitates comparison of results across different studies and laboratories .

How can researchers integrate GRA7 studies with broader toxoplasmosis research?

To maximize the impact of GRA7 research within the broader context of toxoplasmosis studies, researchers should consider these integration strategies:

  • Collaborative research networks:

    • Establish partnerships spanning molecular biology, immunology, and clinical research

    • Coordinate with epidemiologists studying toxoplasmosis prevalence

    • Engage with structural biologists for protein characterization

    • Connect with clinicians handling toxoplasmosis cases

  • Multi-omics approaches:

    • Combine GRA7 studies with broader proteomics of T. gondii secretome

    • Integrate with transcriptomics to understand expression patterns

    • Correlate with metabolomics to assess downstream effects

    • Link with genomics to explore strain variations affecting GRA7

  • Translational research pipeline:

    • Connect basic GRA7 research to diagnostic development

    • Transition promising GRA7-based approaches to clinical validation

    • Address practical implementation in resource-limited settings

  • Systematic experimental design:

    • Apply structured design of experiments approaches

    • Ensure statistical rigor and reproducibility

    • Share standardized protocols and reference materials

    • Publish comprehensive methods to facilitate replication

  • Data sharing and integration:

    • Contribute to toxoplasmosis research databases

    • Adopt common data standards and ontologies

    • Make GRA7-related datasets publicly accessible

    • Participate in meta-analyses of T. gondii virulence factors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.