Recombinant Derlin-1 (cup-2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Derlin-1 (CUP-2)

Recombinant Derlin-1 (CUP-2) refers to the engineered production of the Caenorhabditis elegans protein CUP-2, a member of the Derlin family involved in endoplasmic reticulum-associated degradation (ERAD). This protein is structurally and functionally homologous to human Derlin-1, a key component of the ERAD pathway responsible for retrotranslocation of misfolded proteins into the cytosol for degradation . Recombinant CUP-2 is utilized in research to study ER stress, unfolded protein response (UPR), and its role in suppressing Notch-dependent tumorigenesis in model organisms .

3.1. Suppression of Notch-Dependent Tumors

Studies in C. elegans demonstrate that CUP-2 knockdown or mutation reduces GLP-1/Notch signaling and suppresses germline tumors in puf-8; glp-1(gf) mutants . This suppression is UPR-dependent, as chemically induced ER stress mimics the tumor-suppressive effects .

Experimental ModelPhenotypeMechanismSource
cup-2(tm2838); glp-1(gf)Reduced proliferative zone sizeReduced GLP-1/Notch signaling
cup-2 RNAi in rrf-1 mutantsPartial tumor suppression in germlineGermline-specific UPR activation

3.2. Partial Redundancy with DER-2

CUP-2 and DER-2 (another C. elegans Derlin) exhibit partial functional redundancy in ERAD and UPR. Double mutants (cup-2; der-2) show exacerbated UPR activation compared to single mutants .

3.3. Localization and Expression

CUP-2 is expressed throughout the C. elegans germline, with lower levels in the distal proliferative zone. It co-localizes with ER markers (e.g., SP12) and is also present in cytoplasmic endosomal compartments, suggesting roles in retrograde transport .

Applications in Research

4.1. ER Stress and UPR Studies
Recombinant CUP-2 is used to investigate ERAD efficiency and UPR activation. For example, cup-2 mutants show elevated hsp-4::GFP expression, a UPR reporter .

4.2. Cancer and Developmental Biology

  • Tumor Suppression: CUP-2 loss reduces Notch-driven overproliferation, linking ERAD dysfunction to oncogenic signaling .

  • Brain Development: While CUP-2 itself is not brain-specific, Derlin-1/2 homologs in mammals regulate cholesterol biosynthesis and neurite outgrowth, highlighting conserved roles .

4.3. Structural and Therapeutic Insights
Human Derlin-1 and Derlin-3 can rescue cup-2 mutants, indicating functional conservation . Structural studies of recombinant CUP-2 could elucidate retrotranslocation mechanisms and inform therapeutic strategies targeting ERAD .

Technical Considerations

5.1. Production and Tagging
Recombinant CUP-2 is typically expressed with epitope tags (e.g., V5::2XFLAG) for detection. CRISPR-Cas9 editing enables endogenous tagging in C. elegans, preserving native expression patterns .

5.2. Rescue Experiments
Human Derlin-1 and Derlin-3 restore ERAD and endocytosis defects in cup-2 mutants, confirming cross-species functional homology .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them in your order remarks. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cup-2; der-1; F25D7.1; Derlin-1; Coelomocyte uptake defective protein 2; DER1-like protein 1; cDerlin-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
cup-2
Target Protein Sequence
MDLENFLLGIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIY YPVTPQTGFHWLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFL LEPMVISVLYVWCQVNKDTIVSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGH AYFFVALKYPDEYGVDLISTPEFLHRLIPDEDGGIHGQDGNIRGARQQPRGHQWPGGVGA RLGGN
Uniprot No.

Target Background

Function
Derlin-1 (cup-2) plays a crucial role in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. It facilitates the transfer of misfolded proteins from the ER to the cytosol, where they are subsequently destroyed by the proteasome in a ubiquitin-dependent manner.
Database Links

KEGG: cel:CELE_F25D7.1

STRING: 6239.F25D7.1.1

UniGene: Cel.18892

Protein Families
Derlin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Derlin-1 and how does it relate to cup-2 in C. elegans?

Derlin-1 is a multi-pass transmembrane protein that functions in endoplasmic reticulum-associated degradation (ERAD) and retrograde transport from endosomes to the Golgi apparatus. In C. elegans, cup-2 is the homolog that shares functional similarities with mammalian Derlin-1. Both proteins serve as channels or adapters for the retrotranslocation of misfolded proteins from the ER lumen to the cytosol for degradation . Additionally, they interact with sorting nexins (like SNX-1) to facilitate retrograde transport of membrane proteins .

For studying functional conservation between species, researchers typically employ complementation assays where cup-2 is expressed in mammalian systems lacking Derlin-1 (or vice versa) to determine whether the ortholog can rescue the mutant phenotype.

What is the subcellular localization pattern of Derlin-1/cup-2?

Derlin-1/cup-2 exhibits dual localization, primarily to the endoplasmic reticulum (ER) membrane but also to endosomes. This has been confirmed through co-localization studies with ER markers such as SP12, a signal peptidase . When studying localization, researchers should employ:

  • Immunofluorescence with organelle-specific markers

  • Subcellular fractionation followed by western blotting

  • Live-cell imaging with fluorescently tagged Derlin-1/cup-2

Importantly, CUP-2 expression studies in C. elegans germline show that while a significant proportion colocalizes with ER markers, some CUP-2 is present in the cytoplasm of germ cells, potentially associated with endosomal compartments .

How many Derlin family proteins exist across species and how are they functionally related?

The Derlin family consists of:

  • In mammals: three members (Derlin-1, Derlin-2, and Derlin-3)

  • In C. elegans: two members (CUP-2 and DER-2)

Despite structural similarities, these proteins show functional specialization. DER-2 is considered the functional ortholog of yeast Der1p, as overexpression of C. elegans DER-2 in yeast Δder1 Δire1 strains partially restores degradation of Der1p-associated ERAD substrates .

How does the unfolded protein response (UPR) regulate Derlin expression?

Derlin family members are regulated by the UPR, particularly through the IRE1-XBP1 pathway. Northern blot hybridization studies demonstrate that Derlin-1 and Derlin-2 mRNA are induced in response to ER stress (via tunicamycin treatment), similar to other UPR targets like BiP, though at lower efficiency .

Critical experimental evidence shows that induction of Derlin-1 and Derlin-2 observed in wild-type cells is greatly attenuated in cells lacking IRE1α or XBP1, confirming they are targets of the IRE1-XBP1 pathway . This regulation mechanism appears to be conserved, as cup-2 mutants in C. elegans show high expression of hsp-4::gfp, a reporter for XBP-1-dependent UPR activation .

Methodologically, researchers studying this regulation should employ:

  • Promoter analysis to identify UPR elements

  • ChIP assays to verify XBP1 binding

  • Reporter constructs to monitor expression under different stress conditions

  • Gene knockout studies targeting UPR components

What experimental approaches are effective for studying Derlin-1/cup-2 interactions with other proteins?

To study Derlin-1/cup-2 protein interactions, researchers should employ multiple complementary techniques:

  • Yeast two-hybrid assays: Both conventional and split-ubiquitin systems. Studies confirm that CUP-2 interacts with SNX-1 in conventional yeast two-hybrid assays, while R151.6 (the second C. elegans Derlin) does not .

  • Co-immunoprecipitation: Useful for detecting stable complexes, particularly with p97/VCP, mammalian homologs of yeast Hrd1p and Hrd3p, and components of the retromer complex .

  • Proximity labeling: Techniques like BioID can identify proteins in close proximity to Derlin-1/cup-2 in living cells.

  • Crosslinking studies: Particularly useful for capturing transient interactions during ERAD or retrograde transport processes.

When designing interaction studies, researchers should include appropriate controls and consider that Derlin-1/cup-2 interactions may be dynamic and context-dependent, varying under different cellular conditions.

How can researchers differentiate between the ERAD and retrograde transport functions of Derlin-1/cup-2?

Distinguishing between Derlin-1/cup-2's dual functions requires careful experimental design:

  • Genetic approaches: Compare phenotypes of mutations in genes specific to each pathway. For example, studies show that snx-1(tm847) mutations suppress Notch-dependent tumors, but to a much lesser extent than cup-2 mutations, suggesting retrograde transport only partially contributes to cup-2's role in proliferation regulation .

  • Domain-specific mutations: Target distinct protein regions responsible for each function.

  • Substrate specificity: Analyze different substrates known to specifically require either ERAD (misfolded ER proteins) or retrograde transport (certain membrane proteins like MCA-3) .

  • Tissue-specific requirements: Studies in C. elegans using rrf-1 mutants (where RNAi primarily affects the germline but not somatic tissues) show that cup-2 RNAi still suppresses tumors, indicating cup-2's role is in the germline rather than somatic tissue .

  • Chemical modulation: Employ specific inhibitors of each pathway to isolate functional contributions.

How does Derlin-1/cup-2 contribute to Notch signaling regulation and tumor suppression?

Derlin-1/cup-2 has significant effects on Notch signaling, with important implications for tumor development. Studies in C. elegans demonstrate that:

  • Mutations in cup-2 and der-2 suppress germline tumor formation resulting from increased GLP-1/Notch signaling .

  • This suppression is specific to Notch gain-of-function mutations, as cup-2 mutations do not suppress other mutations that cause over-proliferation .

  • Reduction of CUP-2 Derlin activity reduces the expression of GLP-1/Notch signaling reporters, suggesting suppression occurs through reduced activity of the mutated GLP-1/Notch receptor .

  • Suppression in cup-2 mutants is only effective when the UPR is functioning properly, suggesting that UPR activation may be the mechanism through which Derlin mutations affect Notch signaling .

  • Chemical induction of ER stress similarly suppresses glp-1(gf) over-proliferation but not other mutations causing over-proliferation, further supporting this mechanism .

This relationship provides valuable insights for cancer research, suggesting potential therapeutic approaches targeting ER stress pathways in Notch-dependent cancers.

What are the molecular mechanisms by which cup-2 mutations suppress Notch-dependent tumors?

The molecular mechanisms underlying tumor suppression by cup-2 mutations involve several interconnected pathways:

  • UPR activation: cup-2 mutations lead to accumulation of misfolded proteins and UPR induction. Research demonstrates that this suppression requires xbp-1, a key UPR component, suggesting UPR activation is a critical mechanism .

  • Direct effects on Notch receptor: cup-2 mutations may affect GLP-1/Notch receptor folding, trafficking, or degradation, reducing signaling output. This is supported by decreased expression of Notch signaling reporters in cup-2 mutants .

  • Retrograde transport contribution: While cup-2's retrograde transport function (with SNX-1) contributes to tumor suppression, it appears to be a minor component compared to the ERAD/UPR-related mechanisms. Studies show snx-1 mutations suppress tumors much less effectively than cup-2 mutations .

  • ER stress induction: Chemical induction of ER stress mimics the tumor-suppressive effects of cup-2 mutations, suggesting a causal relationship .

For researchers investigating these mechanisms, experiments should include genetic epistasis analysis, protein trafficking studies, and targeted manipulation of UPR components.

What is the relationship between Derlin-1/cup-2 and the retromer complex?

Derlin-1/cup-2 interfaces with the retromer complex, which mediates retrograde transport from endosomes to the Golgi apparatus. Key findings include:

  • Physical association: CUP-2 physically interacts with SNX-1 (Sorting Nexin-1), a component of the retromer complex, as demonstrated by yeast two-hybrid assays .

  • Functional connection: Some retromer mutants phenocopy plasma membrane/endosomal defects of cup-2 and snx-1 mutants, suggesting shared functions in membrane protein trafficking .

  • Structure of the retromer: The complex consists of two subcomplexes - an Snx1/2-Snx5/6 dimer and a Vps26-Vps29-Vps35 trimer .

  • Notch signaling effects: There is an emerging connection between the retromer complex and Notch signaling, with retromer potentially affecting Notch receptor trafficking .

Researchers investigating this relationship should consider examining:

  • The exact composition of Derlin-1/cup-2-retromer complexes

  • Substrate specificity of these complexes

  • How complex formation is regulated under different conditions

  • Whether targeting this interaction could have therapeutic potential in Notch-dependent diseases

What expression systems are most effective for producing functional recombinant Derlin-1/cup-2?

Producing functional recombinant Derlin-1/cup-2 presents significant challenges due to its multiple transmembrane domains. Researchers should consider:

  • Expression systems:

    • Insect cells (Sf9, High Five) provide proper eukaryotic folding machinery

    • Mammalian cells (HEK293, CHO) offer native post-translational modifications

    • Yeast systems may be suitable for certain applications, as demonstrated by complementation studies with DER-2 in yeast

  • Construct design:

    • Purification tags (His, FLAG, GST) should be carefully positioned to avoid interfering with function

    • Codon optimization for the chosen expression system

    • Consider fusion partners to improve solubility (MBP, SUMO)

    • Domain-specific constructs may be more stable than full-length protein

  • Purification strategy:

    • Gentle detergent extraction (DDM, LMNG)

    • Membrane fraction preparation

    • Size exclusion chromatography to ensure homogeneity

  • Validation approaches:

    • Binding assays with known partners (p97/VCP, SNX-1)

    • Structural integrity assessment (CD spectroscopy)

    • Functional complementation in Derlin-depleted cells

How can researchers effectively study the dual localization of Derlin-1/cup-2 to both ER and endosomes?

Studying the dual localization of Derlin-1/cup-2 requires specialized approaches:

  • Immunofluorescence microscopy:

    • Co-staining with compartment-specific markers (SP12 for ER, EEA1 for early endosomes)

    • Super-resolution techniques for precise localization

    • Time-lapse imaging to track dynamic localization changes

  • Biochemical fractionation:

    • Differential centrifugation to separate organelles

    • Density gradient separation of ER and endosomal fractions

    • Western blotting of fractions with Derlin-1/cup-2 antibodies

  • Compartment-specific mutations:

    • Identify and mutate targeting signals for each compartment

    • Create chimeric proteins with known targeting sequences

  • Functional validation:

    • Assess compartment-specific functions using targeted mutations

    • Determine whether different pools of Derlin-1/cup-2 interact with distinct partners

Research has shown that while a proportion of CUP-2 colocalizes with the ER marker SP12 in C. elegans germ cells, some is present in the cytoplasm, potentially associated with endosomal compartments for retrograde transport .

What control experiments are essential when studying the effects of Derlin-1/cup-2 on Notch signaling?

When investigating Derlin-1/cup-2 effects on Notch signaling, essential controls include:

  • Genetic controls:

    • Multiple alleles of glp-1/Notch should be tested (e.g., glp-1(ar202gf) and glp-1(oz264gf))

    • Test other mutations causing over-proliferation unrelated to Notch (to confirm specificity)

    • Compare single and double mutants (e.g., cup-2;der-2) to assess redundancy

  • Tissue specificity controls:

    • Use tissue-specific RNAi (e.g., rrf-1 mutants for germline-specific effects)

    • Compare somatic versus germline phenotypes

  • Pathway controls:

    • Test effects on direct Notch targets versus indirect outcomes

    • Examine upstream ligands and downstream effectors

    • Assess whether effects occur at receptor level or elsewhere

  • UPR relationship controls:

    • Test whether chemical ER stress inducers phenocopy Derlin mutations

    • Examine dependency on UPR components like xbp-1

    • Include UPR-independent stresses as controls

  • Quantification approaches:

    • Count cell numbers in proliferative zones

    • Score phenotypes across multiple categories (e.g., complete tumor, partial tumor, wild-type)

    • Use appropriate statistical analyses with sufficient sample sizes

These controls help establish causality and mechanism rather than mere correlation.

What approaches can differentiate between ERAD and endosomal quality control functions of Derlin-1/cup-2?

Distinguishing between Derlin-1/cup-2's dual quality control functions requires specialized approaches:

  • Substrate-specific analysis:

    • Compare ER-localized versus endosome/plasma membrane substrates

    • For example, studies show cup-2 mutations cause accumulation of MCA-3 (a Membrane Calcium ATPase) at the plasma membrane, independent of ERAD functions

  • Compartment-specific partners:

    • Compare interactions with ERAD-specific partners (e.g., p97/VCP) versus endosomal partners (e.g., SNX-1)

    • Analyze whether these interactions occur in distinct complexes

  • Separation of function mutations:

    • Create mutations that specifically disrupt one function but not the other

    • Domain mapping to identify regions critical for each function

  • Temporal analysis:

    • Study acute versus chronic loss of Derlin function

    • Determine whether one function precedes the other

  • Biophysical approaches:

    • Analyze aggregation state and folding of different substrate classes

    • Determine whether different mechanisms are employed for different substrate types

FunctionKey PartnersModel SubstratesDetection Methods
ERADp97/VCP, Hrd1, Sel1LMisfolded ER proteinsProtein stability assays, ubiquitination detection
Endosomal QCSNX-1, RetromerMembrane proteins (e.g., MCA-3)Surface biotinylation, endocytosis assays

Research clearly demonstrates that cup-2 has distinct functions in plasma membrane/endosomal quality control that are independent of its ERAD functions .

How can researchers effectively study the relationship between ER stress, Derlin function, and tumor suppression?

Investigating the relationship between ER stress, Derlin function, and tumor suppression requires integrated approaches:

  • Genetic manipulation:

    • Create double mutants between Derlin genes and UPR components (e.g., cup-2;xbp-1)

    • Use conditional alleles to control timing of ER stress induction

  • Chemical approaches:

    • Treat animals/cells with ER stress inducers (tunicamycin, thapsigargin) and measure tumor phenotypes

    • Use selective UPR branch inhibitors to dissect mechanisms

  • Reporter systems:

    • Monitor UPR activation (hsp-4::gfp) in Derlin mutant backgrounds

    • Track Notch signaling outputs in response to ER stress

  • Transcriptomics/proteomics:

    • Compare gene expression profiles in Derlin mutants versus chemically-induced ER stress

    • Identify proteins whose stability is affected in both conditions

  • Therapeutic applications:

    • Test whether ER stress-inducing drugs suppress Notch-dependent tumors in models beyond C. elegans

    • Develop selective modulators of Derlin function as potential therapeutic agents

Research has established that cup-2 mutant suppression of glp-1(gf) tumors requires functional xbp-1, and chemical induction of ER stress mimics the tumor-suppressive effects of cup-2 mutations . This suggests targeting ER stress pathways could be a viable therapeutic approach for Notch-dependent cancers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.