Recombinant Desmodillus auricularis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Desmodillus auricularis (Cape short-eared gerbil)
Target Names
Target Protein Sequence
MAYPMQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYLISLMLTTKLIHTNTMDAQE VETIWTILPAIILVLIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNELKPGELRLLEVDNRVILPIELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGIFYGQCSEICGSNHSFMPIVLEMIPLKFFENWSSSMT
Uniprot No.

Target Background

Function

Recombinant Desmodillus auricularis Cytochrome c oxidase subunit 2 (MT-CO2) Background:

MT-CO2 is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (CIV). These complexes work collaboratively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1—a binuclear center (BNC) formed by heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase Subunit 2 (MT-CO2) and what is its role in cellular metabolism?

MT-CO2 is a critical component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This protein plays an essential role in oxidative phosphorylation by:

  • Facilitating the initial transfer of electrons from cytochrome c to cytochrome c oxidase

  • Contributing to the catalytic reduction of oxygen to water

  • Participating in proton pumping across the inner mitochondrial membrane

In Desmodillus auricularis (Cape short-eared gerbil), as in other mammals, MT-CO2 is encoded by mitochondrial DNA and contains functional domains that interact with cytochrome c for electron transfer .

Why is Desmodillus auricularis specifically selected for MT-CO2 research?

Desmodillus auricularis offers several advantages as a research model:

  • It is a desert-adapted rodent with potentially unique metabolic adaptations

  • As a member of the Gerbillinae subfamily, it provides insights into rodent evolution and molecular systematics

  • Its MT-CO2 sequence contains phylogenetically informative variation for comparative studies

  • The species may exhibit metabolic adaptations relevant to understanding energy conservation mechanisms in arid environments

What are the physical and biochemical properties of recombinant Desmodillus auricularis MT-CO2?

PropertyCharacteristic
Protein LengthFull length (typically 227-230 amino acids)
Expression SystemE. coli (most common)
Molecular WeightApproximately 26 kDa (including tag)
Purification TagTypically His-tagged for affinity purification
Storage BufferTris/PBS-based buffer, pH 8.0, often with 5-50% glycerol
StabilityBetter preserved at -20°C/-80°C; multiple freeze-thaw cycles not recommended

What are the optimal protocols for reconstitution and storage of lyophilized recombinant MT-CO2?

For optimal reconstitution and storage:

  • Centrifuge the vial briefly before opening to collect material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 30-50% for long-term storage

  • Aliquot into smaller volumes to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C or preferably -80°C

Note: Proper reconstitution is critical for maintaining protein structure and function. Improper handling can lead to protein aggregation and loss of activity.

How can researchers assess the functional activity of recombinant MT-CO2 in experimental settings?

To evaluate functional activity of recombinant MT-CO2:

  • Electron transfer capacity assay:

    • Measure the rate of electron transfer from reduced cytochrome c to oxygen

    • Monitor oxygen consumption using oxygen electrodes

    • Assess activity under varying pH and temperature conditions

  • Protein-protein interaction studies:

    • Use surface plasmon resonance (SPR) to measure binding kinetics with cytochrome c

    • Perform co-immunoprecipitation with other components of the respiratory chain

    • Employ crosslinking experiments to identify interaction domains

  • Structural integrity validation:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Limited proteolysis to verify proper folding

    • Thermal shift assays to determine stability under experimental conditions

What experimental approaches can address expression challenges for recombinant MT-CO2?

MT-CO2 expression can be challenging due to its hydrophobic domains. Researchers should consider:

  • Optimization of expression systems:

    • Test multiple E. coli strains (BL21(DE3), Rosetta, C41/C43)

    • Evaluate expression in yeast or insect cell systems for better membrane protein folding

    • Implement low temperature induction (16-20°C) to enhance proper folding

  • Construct optimization:

    • Include solubility-enhancing fusion partners (SUMO, MBP, Trx)

    • Design constructs excluding transmembrane regions if only studying soluble domains

    • Codon optimization for the expression host

  • Purification strategy:

    • Use mild detergents for membrane protein extraction

    • Implement gradient purification protocols to maintain protein stability

    • Consider on-column refolding techniques for enhanced yield

How does MT-CO2 variation contribute to phylogenetic studies of rodents?

MT-CO2 sequences provide valuable phylogenetic information because:

  • The gene shows sufficient variation for resolving relationships at various taxonomic levels

  • In gerbil studies, MT-CO2 has revealed multiple instances of discordance between molecular and morphological phylogenies

  • The protein contains both conserved functional domains and variable regions that evolve at different rates

For phylogenetic analysis, researchers should:

  • Include multiple genetic markers alongside MT-CO2 (including nuclear genes) for robust tree construction

  • Employ appropriate evolutionary models that account for codon position effects

  • Consider the influence of selection pressure on different domains of the protein

What patterns of selection have been observed in MT-CO2 across rodent lineages?

Studies of selection patterns in MT-CO2 have revealed:

  • Most codons are under strong purifying selection (ω << 1) due to functional constraints

  • Approximately 4% of sites may evolve under relaxed selective constraint (ω = 1)

  • Some sites may experience positive selection in specific lineages, particularly those adapting to new environments

  • Selection patterns may differ between transmembrane and peripheral domains

These patterns suggest adaptations to maintain efficient electron transfer while accommodating evolutionary changes in interacting proteins.

How might MT-CO2 contribute to thermoregulation in desert-adapted species like Desmodillus auricularis?

MT-CO2's potential role in thermoregulation of desert rodents involves:

  • Metabolic efficiency optimization:

    • Desert rodents like Desmodillus auricularis may have evolved specific amino acid substitutions in MT-CO2 that optimize electron transfer efficiency at varying temperatures

    • These adaptations could contribute to the species' ability to maintain energy balance in arid environments

  • Potential connection to torpor mechanisms:

    • Some desert rodents employ torpor as an energy conservation strategy

    • MT-CO2 modifications might facilitate respiratory chain function at lower body temperatures during torpor states

    • While torpor use varies among species, the capability for controlled metabolism reduction has been observed in some Australian murine rodents

  • Thermal adaptation hypothesis:

    • MT-CO2 variants may influence the temperature sensitivity of cytochrome c oxidase activity

    • Amino acid substitutions could alter proton pumping efficiency at different temperatures

    • These adaptations potentially contribute to the species' desert survival mechanism

What are the recommended controls and validation experiments when studying recombinant MT-CO2 function?

For rigorous experimental design, researchers should implement:

  • Protein quality controls:

    • SDS-PAGE with Coomassie staining to verify purity (>90% recommended)

    • Western blot with anti-His antibodies or MT-CO2-specific antibodies

    • Mass spectrometry to confirm protein identity and integrity

  • Functional validation:

    • Comparison with commercially available cytochrome c oxidase standards

    • Parallel experiments with MT-CO2 from well-characterized species (e.g., mouse, human)

    • Enzyme kinetics studies under standardized conditions

  • Specificity controls:

    • Site-directed mutagenesis of key residues to confirm structure-function relationships

    • Competitive inhibition assays to verify binding site specificity

    • Negative controls using denatured protein or known inhibitors

How can researchers use recombinant MT-CO2 to study evolutionary adaptations in energy metabolism?

Advanced applications include:

  • Comparative biochemistry approaches:

    • Express and characterize MT-CO2 from multiple species that inhabit different environments

    • Measure enzyme kinetics parameters (Km, Vmax, catalytic efficiency) across temperature ranges

    • Analyze the effect of pH and ion concentrations on activity across species variants

  • Structure-function relationship studies:

    • Create chimeric proteins combining domains from different species

    • Use site-directed mutagenesis to introduce species-specific amino acid changes

    • Perform molecular dynamics simulations to predict functional effects of sequence variations

  • Metabolic network integration:

    • Reconstitute respiratory complexes with components from different species

    • Measure the efficiency of electron transfer in mixed systems

    • Evaluate the co-evolution of nuclear and mitochondrially encoded subunits

What technical challenges should researchers anticipate when working with MT-CO2 in functional assays?

Key technical considerations include:

  • Maintaining protein functionality:

    • The protein contains hydrophobic regions that can affect solubility

    • Proper folding is critical for maintaining the copper-binding sites essential for electron transfer

    • The native environment includes membrane lipids that may need to be mimicked in vitro

  • Assay limitations:

    • Activity measurements require careful control of oxygen concentration

    • Redox state of cytochrome c must be precisely maintained

    • Background oxidation can interfere with measurements

  • Species-specific considerations for Desmodillus auricularis:

    • Limited reference data compared to model organisms

    • Possible unique post-translational modifications not reproduced in recombinant systems

    • Need for specialized antibodies or detection methods for species-specific studies

How might the study of Desmodillus auricularis MT-CO2 contribute to understanding metabolic adaptations to climate change?

This research area has significant potential:

  • Desert-adapted species like Desmodillus auricularis may possess molecular adaptations in MT-CO2 that optimize energy production under heat stress

  • Comparing MT-CO2 from species across aridity gradients could reveal evolutionary mechanisms for adapting to increasing temperatures

  • Functional studies of thermostability in MT-CO2 variants may provide insights into metabolic resilience mechanisms

What integrative approaches can enhance our understanding of MT-CO2 evolution in rodents?

Future research should consider:

  • Multi-omics integration:

    • Combine MT-CO2 sequence data with proteomics and metabolomics

    • Correlate MT-CO2 variants with respiratory efficiency measurements

    • Integrate with ecological and behavioral data to understand functional significance

  • Comprehensive phylogenetic approaches:

    • Include dense sampling across rodent families, particularly desert specialists

    • Combine mitochondrial and nuclear genes for robust evolutionary analysis

    • Implement molecular clock analyses to date adaptive changes

  • Experimental evolution studies:

    • Expose model organisms to selective pressures mimicking desert conditions

    • Track changes in MT-CO2 expression and function

    • Use CRISPR-Cas9 to introduce Desmodillus auricularis MT-CO2 variants into model systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.