Recombinant Desulfatibacillum alkenivorans Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Functional Context

HtpX proteases belong to the M48 peptidase family, involved in:

  • Quality control of membrane proteins

  • Stress-response pathways via regulated intramembrane proteolysis (RIP)

  • Zinc-dependent cleavage of misfolded membrane proteins

While structural activation mechanisms are better characterized in homologs like Pseudomonas aeruginosa AlgW , HtpX shares functional parallels in sensing envelope stress through PDZ domain interactions .

Expression Systems

  • Expressed in E. coli with codon optimization

  • Alternative systems available: Yeast, Baculovirus, Mammalian cells

Reconstitution Guidelines

StepParameterRequirement
1Solubilization0.1-1.0 mg/mL in H₂O
2StabilizationAdd 5-50% glycerol
3Aliquot SizeSingle-use portions
4Freeze-Thaw Cycles≤3 to prevent degradation

(Data from )

Research Applications

Documented uses include:

  • Substrate specificity assays for bacterial proteases

  • Structural studies of zinc-dependent catalytic mechanisms

  • Development of ELISA-based detection systems

Stability Profile

Critical stability factors:

ConditionToleranceEffect of Violation
Temperature4°C (1 week); -80°C (long-term)Aggregation ≥25°C
pH Range7.4-8.0Precipitation beyond range
Reducing AgentsNot characterizedPotential disulfide rupture

(Lyophilized format shows enhanced stability over liquid formulations )

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order remarks. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; Dalk_2050; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Desulfatibacillum alkenivorans (strain AK-01)
Target Names
htpX
Target Protein Sequence
MGNQIKSVMLLTAMTAFLLIVGQLIGGRAGMTFALIMAVGMNFFSYWYSDKIVLKMYRAK EVNPGQALELYGIVQRLSSNAGLPMPKVYIIPQQAPNAFATGRNPDHAVVAVTEGLLNLM NREELAGVLAHELAHVKNRDILIGTIAATMAGAVMFLASMAKWGAIFGGFGGNDDDSPLG FAGMLIMAILAPIGAALIQMTISRTREYQADATGAQIAGNPKGLANALAKLGAYSGRIPM DAEPATAHMFIVNPLSGKSLATLFSTHPPLEERIARLTGARPQSGGAPSGPERTARNAED SAKDFWDSLK
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Desulfatibacillum alkenivorans Protease HtpX homolog (htpX)?

Recombinant Desulfatibacillum alkenivorans Protease HtpX homolog (htpX) is a full-length protein (1-310 amino acids) belonging to the M48 family of zinc metalloproteinases. This recombinant protein is expressed in E. coli with an N-terminal His tag and shares homology with HtpX proteases found in other bacterial species, including E. coli. The protein has the UniProt ID B8FG65 and is derived from Desulfatibacillum alkenivorans, an anaerobic bacterium known for its ability to metabolize n-alkanes in anaerobic ecosystems .

HtpX homologs function as membrane proteases involved in the quality control of membrane proteins, helping to eliminate malfolded or misassembled membrane proteins that could disturb cellular membrane structure and function . These proteases play important roles in maintaining membrane integrity and cellular homeostasis in bacterial systems.

What optimal storage and handling conditions should be maintained for research applications?

For optimal storage and handling of Recombinant Desulfatibacillum alkenivorans Protease HtpX homolog (htpX), researchers should follow these evidence-based protocols:

  • Long-term storage:

    • Store the lyophilized powder at -20°C to -80°C upon receipt

    • Aliquot the protein for multiple use to prevent repeated freeze-thaw cycles

    • Working aliquots can be maintained at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage (-20°C/-80°C)

  • Buffer conditions:

    • The protein is shipped in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

    • Maintain pH around 8.0 for optimal stability

  • Quality considerations:

    • Verify purity using SDS-PAGE (should be >90%)

    • Monitor activity after reconstitution using appropriate assays

    • Consider the addition of zinc ions for activity assays as this is a zinc metalloproteinase

How can researchers establish an effective in vivo assay system for Desulfatibacillum alkenivorans Protease HtpX homolog activity?

Establishing an effective in vivo assay system for Desulfatibacillum alkenivorans Protease HtpX homolog activity can be approached based on methodologies developed for homologous proteins such as E. coli HtpX:

  • Model substrate construction:

    • Design a model substrate similar to HtpX model substrate 1 (XMS1) described for E. coli HtpX

    • Incorporate reporter tags (such as fluorescent proteins) that allow detection of proteolytic cleavage

    • Include transmembrane segments that mimic natural substrates of membrane proteases

  • Expression system selection:

    • Use an appropriate bacterial expression system that allows for membrane integration

    • Consider co-expression with the HtpX protein to observe proteolytic activity in vivo

    • Establish control systems with catalytically inactive HtpX mutants

  • Detection methodology:

    • Implement western blotting techniques to detect cleaved fragments

    • Use antibodies against tag epitopes positioned on both sides of the expected cleavage site

    • Employ fluorescence-based detection methods if using fluorescent protein fusions

  • Quantification approaches:

    • Develop semi-quantitative analysis based on band intensity ratios

    • Calculate the efficiency of cleavage under different conditions

    • Compare wild-type and mutant Protease HtpX homolog activities

This system would enable researchers to investigate the function of Desulfatibacillum alkenivorans Protease HtpX homolog in a cellular context and explore factors affecting its activity, such as membrane perturbations or stress conditions.

What expression systems and purification strategies are optimal for obtaining functional recombinant protein?

Optimal expression and purification of functional Recombinant Desulfatibacillum alkenivorans Protease HtpX homolog requires specialized approaches for membrane proteins:

  • Recommended expression systems:

    • E. coli-based expression: Use specialized strains designed for membrane protein expression such as C41(DE3) or C43(DE3)

    • Induction conditions: Lower temperatures (16-20°C) and reduced inducer concentrations to prevent aggregation

    • Vector design: Include fusion tags (N-terminal His-tag is established) and consider additional solubility-enhancing tags if needed

    • Media supplementation: Add zinc to growth media to ensure proper incorporation into the metalloproteinase

  • Membrane extraction methodology:

    • Detergent screening: Test multiple detergents (DDM, LDAO, Triton X-100) for optimal extraction efficiency

    • Solubilization conditions: Optimize buffer composition, detergent concentration, and temperature

    • Alternative approaches: Consider membrane scaffold proteins or nanodiscs for maintaining native-like environment

  • Purification protocol:

    • Immobilized metal affinity chromatography: Utilize the His-tag for initial purification

    • Size exclusion chromatography: Remove aggregates and isolate homogeneous protein populations

    • Buffer optimization: Include stabilizing agents (glycerol, specific lipids) in all purification buffers

    • Quality control: Assess purity by SDS-PAGE (>90% recommended) and verify zinc content

  • Activity preservation:

    • Add low concentrations of zinc to all buffers to prevent cofactor loss

    • Avoid strong chelating agents during purification

    • Consider reconstitution into liposomes or other membrane mimetics for functional studies

This comprehensive approach maximizes the likelihood of obtaining functionally active Recombinant Desulfatibacillum alkenivorans Protease HtpX homolog suitable for biochemical and structural studies.

What analytical techniques should be employed to characterize the enzyme kinetics of the protease?

Characterizing the enzyme kinetics of Recombinant Desulfatibacillum alkenivorans Protease HtpX homolog requires specialized techniques appropriate for membrane proteases:

  • Substrate preparation and considerations:

    • Design peptide substrates containing predicted cleavage sites

    • Develop FRET-based substrates with appropriate fluorophore-quencher pairs

    • Consider membrane-embedded or detergent-solubilized substrates to mimic natural environment

    • Prepare a range of substrate concentrations for Michaelis-Menten kinetics

  • Activity assay methodologies:

    • Continuous monitoring: Track proteolytic activity in real-time using fluorogenic substrates

    • Discontinuous methods: Analyze reaction aliquots at defined timepoints using SDS-PAGE or HPLC

    • Specialized techniques: Consider surface plasmon resonance for binding kinetics or isothermal titration calorimetry for thermodynamic parameters

  • Kinetic parameter determination:

    • Calculate Michaelis-Menten parameters (Km, Vmax, kcat)

    • Determine catalytic efficiency (kcat/Km)

    • Assess the effects of pH, temperature, ionic strength, and detergent concentration

    • Evaluate the influence of zinc concentration on activity

  • Data analysis approaches:

    • Apply appropriate kinetic models accounting for membrane protein characteristics

    • Use non-linear regression for parameter fitting

    • Consider product inhibition or substrate depletion in data interpretation

    • Compare kinetic parameters with those of homologous proteases

This systematic approach provides comprehensive characterization of the catalytic properties of Recombinant Desulfatibacillum alkenivorans Protease HtpX homolog, enabling comparisons with other HtpX family members and establishing the foundation for substrate specificity studies.

How does the structure of Desulfatibacillum alkenivorans Protease HtpX homolog compare to HtpX proteases from other bacterial species?

While a high-resolution structure of Desulfatibacillum alkenivorans Protease HtpX homolog has not been experimentally determined, comparative analysis with characterized HtpX proteins reveals important structural features:

  • Predicted domain organization:

    • Like E. coli HtpX, the Desulfatibacillum alkenivorans homolog likely contains multiple transmembrane segments

    • The protease is expected to have four hydrophobic regions (H1-H4) that may function as transmembrane segments

    • A conserved zinc-binding motif (HEXXH) characteristic of M48 family metalloproteinases should be present in the catalytic domain

    • Controversy exists regarding whether C-terminal hydrophobic regions are membrane-embedded in HtpX proteins

  • Sequence analysis and conservation:

    • The 310 amino acid sequence shows specific regions of high conservation across bacterial species, particularly in catalytic residues

    • Transmembrane topology prediction suggests similarities to other HtpX proteases, with the catalytic domain positioned to access membrane-proximal substrates

    • Species-specific variations likely reflect adaptation to the anaerobic lifestyle of Desulfatibacillum alkenivorans

  • Functional implications of structural organization:

    • The membrane integration pattern determines substrate accessibility

    • The positioning of the active site relative to the membrane influences which portions of substrate proteins can be cleaved

    • Structural adaptations may relate to the specific stresses encountered in anaerobic environments or during n-alkane metabolism

Detailed structural characterization would significantly advance our understanding of this protease's mechanism and substrate specificity, potentially revealing adaptations unique to anaerobic bacteria.

What is known about the catalytic mechanism of HtpX proteases and how might this apply to the Desulfatibacillum alkenivorans homolog?

The catalytic mechanism of HtpX proteases, which likely applies to the Desulfatibacillum alkenivorans homolog, involves several coordinated steps characteristic of zinc metalloproteinases:

  • Active site architecture:

    • A zinc ion is coordinated by two histidine residues within the conserved HEXXH motif

    • A water molecule activated by the zinc ion serves as the nucleophile for peptide bond hydrolysis

    • The glutamate residue within the HEXXH motif functions as a general base, activating the water molecule

  • Substrate binding and recognition:

    • Substrates are likely recognized through both sequence-specific interactions and structural features

    • The transmembrane topology of HtpX positions the active site to access specific regions of membrane protein substrates

    • Studies with E. coli HtpX suggest recognition of misfolded or damaged membrane proteins, indicating conformational sensing capabilities

  • Proteolytic activity regulation:

    • Activity may be regulated through conformational changes in response to stress conditions

    • Some bacterial HtpX homologs are induced by membrane damage, including that caused by aminoglycoside antibiotics

    • The anaerobic environment of Desulfatibacillum alkenivorans may influence the redox state of the protease, potentially affecting catalytic activity

  • Proposed reaction mechanism:

    • Zinc-activated water attacks the carbonyl carbon of the peptide bond

    • Formation of a tetrahedral intermediate

    • Collapse of the intermediate, facilitated by proton transfer

    • Release of cleavage products

Understanding this mechanism is essential for designing inhibitors, engineering specificity, and interpreting the effects of mutations in conserved regions of the protein.

How can mutagenesis approaches be optimally designed to investigate functional domains of the protease?

Strategic mutagenesis approaches for investigating functional domains of Recombinant Desulfatibacillum alkenivorans Protease HtpX homolog should target key regions with precise modifications:

  • Catalytic domain mutagenesis:

    • Active site mutations: Replace zinc-coordinating histidines within the HEXXH motif with alanine to abolish catalytic activity

    • Substrate binding pocket: Introduce conservative substitutions in residues predicted to interact with substrates

    • Metal coordination: Create mutations that alter zinc affinity to investigate metal dependence

    • Catalytic glutamate: Modify the general base residue to probe reaction mechanism

  • Transmembrane domain analysis:

    • Topology mapping: Introduce cysteine residues for accessibility studies

    • Membrane integration: Modify the hydrophobicity of predicted transmembrane segments

    • Domain swapping: Replace transmembrane regions with those from other HtpX homologs to investigate specificity

    • Charged residue insertion: Strategically place charged residues to alter membrane positioning

  • Regulatory region investigation:

    • C-terminal modifications: Create truncations to determine the importance of C-terminal regions

    • Potential regulatory sites: Target conserved residues outside the catalytic domain

    • Stress-response elements: Identify and modify regions potentially involved in sensing membrane stress

  • Experimental validation approaches:

    • Employ the in vivo protease activity assay system with model substrates to assess mutant activity

    • Compare expression levels and stability of mutants to wild-type protein

    • Analyze membrane integration using subcellular fractionation

    • Perform complementation studies in htpX knockout systems

This systematic mutagenesis approach provides valuable insights into structure-function relationships and identifies critical residues for catalysis, substrate recognition, and regulation of Desulfatibacillum alkenivorans Protease HtpX homolog.

What role might Desulfatibacillum alkenivorans Protease HtpX homolog play in the organism's adaptation to anaerobic alkane metabolism?

Desulfatibacillum alkenivorans is an anaerobic bacterium capable of metabolizing n-alkanes (C13 to C18), and its Protease HtpX homolog likely plays specialized roles in supporting this unique metabolic capability:

  • Membrane protein quality control during alkane metabolism:

    • Alkane metabolism in anaerobic conditions involves specialized membrane proteins

    • Desulfatibacillum alkenivorans contains genomic loci encoding alkylsuccinate synthase (ASS) gene clusters that catalyze alkane addition to fumarate

    • HtpX may be involved in quality control of these membrane-associated metabolic enzymes

    • Proteolytic removal of damaged alkane-metabolizing proteins would maintain cellular efficiency

  • Stress response during hydrocarbon exposure:

    • Hydrocarbons can cause membrane stress and protein misfolding

    • The HtpX protease likely participates in eliminating damaged membrane proteins resulting from alkane interaction

    • This quality control function would be particularly important during growth on different alkane substrates

    • Transcriptional analysis shows differential gene expression during growth on alkanes versus fatty acids in Desulfatibacillum alkenivorans

  • Coordination with specialized metabolic pathways:

    • The expression of ass gene cluster 1 is induced during growth on alkane substrates

    • HtpX may coordinate with these pathways by regulating the turnover of relevant transporters or metabolic enzymes

    • The protease might participate in remodeling the membrane proteome during shifts between different carbon sources

  • Adaptation to the anaerobic lifestyle:

    • Anaerobic growth imposes unique constraints on protein quality control systems

    • HtpX likely functions under the redox conditions specific to anaerobic environments

    • Its activity may be integrated with other stress response mechanisms adapted to anaerobic conditions

Understanding this specialized role could provide insights into microbial adaptation to challenging carbon sources and environments relevant to bioremediation applications.

How can comparative genomics and evolutionary analysis of HtpX proteases inform our understanding of the Desulfatibacillum alkenivorans homolog?

Comparative genomics and evolutionary analysis of HtpX proteases provide valuable context for understanding the Desulfatibacillum alkenivorans homolog:

  • Phylogenetic distribution and conservation:

    • HtpX proteases are widely distributed across bacterial phyla, indicating fundamental importance

    • Desulfatibacillum alkenivorans HtpX homolog belongs to the M48 family of zinc metalloproteinases

    • Sequence comparison across species reveals both universally conserved regions (likely essential for function) and variable regions (potential adaptations to specific niches)

    • Conservation patterns of transmembrane domains versus catalytic domains provide insights into evolutionary constraints

  • Coevolution with substrate proteins:

    • Analysis of coevolutionary patterns between HtpX and potential substrate proteins

    • Identification of correlated sequence changes that may indicate functional relationships

    • Comparison of HtpX homologs in bacteria with different metabolic capabilities (particularly alkane metabolism)

    • Correlation between HtpX sequence variations and bacterial membrane composition across species

  • Genomic context analysis:

    • Examination of the genomic neighborhood of htpX genes across species

    • Identification of frequently co-occurring genes that may indicate functional relationships

    • In Desulfatibacillum alkenivorans, potential genetic linkage with pathways involved in anaerobic metabolism

    • Comparative analysis with genomic organization in other n-alkane degrading bacteria

  • Selective pressure analysis:

    • Determination of dN/dS ratios to identify regions under purifying or diversifying selection

    • Identification of lineage-specific adaptations in the Desulfatibacillum alkenivorans HtpX homolog

    • Correlation of sequence variations with ecological factors (anaerobic lifestyle, substrate range)

    • Analysis of adaptive evolution in response to different membrane compositions or stress conditions

This evolutionary perspective provides context for experimental findings and generates hypotheses about specialized functions of the Desulfatibacillum alkenivorans Protease HtpX homolog.

What potential biotechnological applications might emerge from research on Desulfatibacillum alkenivorans Protease HtpX homolog?

Research on Desulfatibacillum alkenivorans Protease HtpX homolog offers several promising biotechnological applications:

  • Bioremediation enhancement:

    • Understanding the role of HtpX in anaerobic alkane metabolism could lead to engineered bacterial strains with improved hydrocarbon degradation capabilities

    • Development of optimized proteolytic systems for bacteria used in bioremediation of oil spills or contaminated sediments

    • Creation of biosensors incorporating HtpX-based elements to detect hydrocarbons in environmental samples

    • Desulfatibacillum alkenivorans naturally metabolizes n-alkanes (C13 to C18), making it relevant for bioremediation applications

  • Protein engineering applications:

    • Designing novel proteases with specialized cleavage specificities based on the HtpX scaffold

    • Development of controllable proteolytic systems for biotechnological processes

    • Creation of chimeric enzymes combining features of different HtpX homologs for optimized performance

    • Engineering proteases adapted to function in extreme or non-conventional environments

  • Membrane protein research tools:

    • Utilizing HtpX-based systems as tools for membrane protein quality control in heterologous expression systems

    • Development of selective proteolysis approaches for membrane protein structural studies

    • Creation of assay systems to monitor membrane protein folding and stability

    • Design of protease-based probes for membrane protein topology mapping

  • Antimicrobial strategy development:

    • Targeting bacterial membrane protein quality control as a novel approach for antimicrobial development

    • Identification of inhibitors specific to bacterial HtpX homologs

    • Development of compounds that dysregulate membrane protein homeostasis in pathogens

    • Understanding resistance mechanisms linked to membrane protein quality control systems

These applications leverage the unique properties of HtpX proteases from anaerobic bacteria and their specialized roles in membrane protein quality control under challenging conditions.

What are common challenges when working with recombinant membrane proteases and how can researchers address them?

Working with recombinant membrane proteases like Desulfatibacillum alkenivorans Protease HtpX homolog presents several technical challenges that researchers should anticipate and address:

  • Expression and solubility issues:

    • Challenge: Low expression levels and inclusion body formation

    • Solution: Optimize expression conditions (lower temperature, reduced inducer concentration)

    • Challenge: Protein aggregation during membrane extraction

    • Solution: Screen multiple detergents for optimal extraction; include stabilizing agents like glycerol

    • Challenge: Loss of zinc cofactor during purification

    • Solution: Include low concentrations of zinc in purification buffers; avoid strong chelating agents

  • Purification complications:

    • Challenge: Co-purification of membrane lipids and contaminant proteins

    • Solution: Implement multi-step purification strategies combining affinity and size exclusion chromatography

    • Challenge: Detergent micelle interference with protein concentration determination

    • Solution: Use detergent-compatible protein assays; apply correction factors for detergent contribution

    • Challenge: Protein destabilization during concentration steps

    • Solution: Use centrifugal concentrators with appropriate molecular weight cutoffs; concentrate at lower temperatures

  • Activity assessment difficulties:

    • Challenge: Designing appropriate activity assays for membrane proteases

    • Solution: Develop model substrates with clear readouts; adapt established HtpX assay systems

    • Challenge: Distinguishing specific activity from background proteolysis

    • Solution: Include appropriate controls (heat-inactivated enzyme, catalytically inactive mutants)

    • Challenge: Maintaining active conformation in vitro

    • Solution: Reconstitute in membrane mimetics (nanodiscs, liposomes) for functional studies

  • Storage and stability concerns:

    • Challenge: Activity loss during storage

    • Solution: Store with glycerol (5-50%) at -20°C/-80°C; avoid repeated freeze-thaw cycles

    • Challenge: Detergent-induced denaturation over time

    • Solution: Optimize detergent type and concentration; consider detergent exchange during purification

    • Challenge: Oxidation of critical residues in anaerobic proteins

    • Solution: Include reducing agents in buffers; consider handling under anaerobic conditions

Addressing these challenges requires systematic optimization and adaptation of protocols specifically for membrane proteases from anaerobic bacteria.

How can researchers verify that recombinant Desulfatibacillum alkenivorans Protease HtpX homolog retains its native conformation and activity?

Verifying that recombinant Desulfatibacillum alkenivorans Protease HtpX homolog maintains its native conformation and activity requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy: Monitor secondary structure elements and compare with predictions

    • Fluorescence spectroscopy: Evaluate tryptophan/tyrosine exposure as indicator of proper folding

    • Size exclusion chromatography: Confirm monomeric state or appropriate oligomerization

    • Thermal shift assays: Measure protein stability and the effect of different buffer conditions

  • Functional verification:

    • Zinc content analysis: Use atomic absorption spectroscopy or colorimetric assays to verify metal incorporation

    • Proteolytic activity assays: Demonstrate cleavage of model substrates designed based on E. coli HtpX studies

    • Inhibitor sensitivity: Confirm expected response to metalloprotease inhibitors

    • Substrate specificity profile: Verify consistency with predicted cleavage preferences

  • Membrane integration analysis:

    • Detergent binding assays: Confirm appropriate interaction with detergent micelles

    • Liposome association studies: Demonstrate membrane association in reconstituted systems

    • Protease protection assays: Map topology by accessibility to proteolytic digestion

    • Membrane fractionation: Verify proper localization when expressed in bacterial hosts

  • Comparative benchmarking:

    • Activity comparison with homologous enzymes: Benchmark against well-characterized HtpX proteases

    • Complementation assays: Test functionality by complementation of htpX mutants in model organisms

    • Response to membrane stress: Verify expected regulation under conditions that perturb membrane integrity

    • Kinetic parameter comparison: Ensure catalytic efficiency is within expected range for this enzyme class

This multi-faceted verification approach provides confidence that the recombinant protein maintains its physiologically relevant conformation and activity, enabling meaningful experimental investigations.

What controls and validation experiments are essential when studying substrate specificity of the protease?

When investigating substrate specificity of Recombinant Desulfatibacillum alkenivorans Protease HtpX homolog, researchers should implement a comprehensive set of controls and validation experiments:

  • Essential negative controls:

    • Heat-inactivated enzyme: Verify that observed proteolysis requires active enzyme

    • Metal chelation controls: Confirm zinc dependence using EDTA or other chelators

    • Catalytically inactive mutants: Test proteolysis with site-directed mutants of zinc-binding residues

    • Non-substrate proteins: Demonstrate selectivity using proteins not expected to be cleaved

  • Substrate validation approaches:

    • Sequencing of cleavage products: Confirm precise cleavage sites by mass spectrometry or Edman degradation

    • Site-directed mutagenesis of putative cleavage sites: Demonstrate loss of processing with modified substrates

    • Concentration-dependent kinetics: Establish Michaelis-Menten parameters for verified substrates

    • Competition assays: Confirm specific binding using unlabeled substrate competitors

  • Specificity verification experiments:

    • Comparative analysis with other proteases: Test substrate processing by different protease classes

    • Domain swapping: Exchange substrate recognition domains between related proteases

    • Synthetic peptide libraries: Systematically map sequence preferences around cleavage sites

    • Structural determinants: Investigate the role of substrate secondary structure in recognition

  • Physiological relevance controls:

    • Native conditions: Test activity under conditions mimicking the natural anaerobic environment

    • Membrane context: Compare proteolysis of soluble versus membrane-embedded substrates

    • Co-expression systems: Validate substrate processing in cellular contexts

    • Correlation with bioinformatic predictions: Compare experimental results with computational substrate predictions

This systematic validation approach ensures that substrate specificity findings are robust, reproducible, and physiologically relevant, while eliminating potential artifacts from experimental conditions.

How does understanding Desulfatibacillum alkenivorans Protease HtpX homolog contribute to the broader field of membrane protein quality control?

Research on Desulfatibacillum alkenivorans Protease HtpX homolog offers significant contributions to our understanding of membrane protein quality control:

  • Evolutionary insights on conserved mechanisms:

    • Investigation of HtpX from this anaerobic bacterium helps identify truly conserved features of membrane protein quality control

    • Comparison with homologs from diverse bacterial species reveals fundamental principles versus adaptations

    • Understanding this protease from a non-model organism broadens our perspective beyond well-studied systems

    • Insights from an alkane-metabolizing bacterium illuminate quality control mechanisms in specialized metabolic contexts

  • Mechanistic understanding of membrane proteases:

    • Detailed characterization of another HtpX homolog strengthens our understanding of this protease family

    • Studies of the Desulfatibacillum alkenivorans enzyme may reveal unique catalytic properties or substrate preferences

    • Investigation of an HtpX from an anaerobic organism provides perspective on how these proteases function under different redox conditions

    • The development of new in vivo assay systems for HtpX activity advances methodologies for studying membrane proteases

  • Integration with stress response networks:

    • Analysis of the protease in context of anaerobic alkane metabolism reveals new stress response connections

    • Understanding how membrane protein quality control operates in extremophiles or specialized metabolic niches

    • Insights into how proteostasis networks adapt to different environmental challenges

    • Potential discovery of novel regulatory mechanisms specific to anaerobic bacteria

  • Translational relevance:

    • Findings may inform approaches to optimize bioremediation processes involving anaerobic bacteria

    • Understanding bacterial adaptation mechanisms may inspire new antimicrobial strategies

    • Insights into protein quality control in specialized bacteria may lead to improved protein production systems

    • Methodological advances could benefit research on membrane proteins across multiple fields

This research expands our understanding beyond model organisms and contributes to a more comprehensive model of membrane protein quality control across diverse bacterial species and environmental conditions.

What emerging technologies might advance research on Desulfatibacillum alkenivorans Protease HtpX homolog and related membrane proteases?

Several emerging technologies hold promise for advancing research on Desulfatibacillum alkenivorans Protease HtpX homolog and related membrane proteases:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy: Determining structures of membrane proteases without crystallization

    • Integrative structural biology: Combining multiple techniques (SAXS, NMR, computational modeling) for comprehensive structural insights

    • Time-resolved crystallography: Capturing conformational states during catalysis

    • Hydrogen-deuterium exchange mass spectrometry: Mapping dynamics and conformational changes

  • Single-molecule techniques:

    • FRET-based conformational analysis: Monitoring structural changes during substrate binding and catalysis

    • Optical tweezers: Measuring forces involved in protein-substrate interactions

    • Nanopore-based detection: Monitoring protease activity with single-molecule sensitivity

    • High-speed AFM: Visualizing protease-substrate interactions in real-time

  • Systems biology integration:

    • Multi-omics approaches: Combining proteomics, metabolomics, and transcriptomics for comprehensive analysis

    • Network modeling: Integrating HtpX function within cellular proteostasis networks

    • Machine learning applications: Predicting substrates and regulatory interactions

    • Genome-wide CRISPR screens: Identifying genetic interactions with htpX

  • Advanced protein engineering:

    • Directed evolution platforms: Developing HtpX variants with enhanced specificity or activity

    • Optogenetic control: Creating light-controllable protease systems

    • Non-canonical amino acid incorporation: Introducing novel functionalities for mechanistic studies

    • De novo design: Engineering artificial membrane proteases based on HtpX scaffolds

These technologies would address current limitations in studying membrane proteases, particularly those from non-model organisms like Desulfatibacillum alkenivorans, enabling more detailed mechanistic insights and expanding potential applications.

What are the most promising directions for future research on anaerobic bacterial membrane proteases like HtpX?

Future research on anaerobic bacterial membrane proteases like Desulfatibacillum alkenivorans Protease HtpX homolog should prioritize several promising directions:

  • Comprehensive substrate identification:

    • Apply unbiased proteomics approaches to identify physiological substrates

    • Develop advanced in vivo substrate trapping methods specific for anaerobic conditions

    • Investigate substrate profiles during different growth conditions and stresses

    • Connect substrate specificity with the unique metabolic capabilities of anaerobic bacteria, particularly during alkane metabolism

  • Regulatory network mapping:

    • Elucidate how HtpX expression and activity are regulated in anaerobic bacteria

    • Identify interaction partners that modulate protease function

    • Characterize the integration of HtpX with other quality control systems under anaerobic conditions

    • Investigate coordination with transcriptional responses during stress, similar to the alkylsuccinate synthase pathway in Desulfatibacillum alkenivorans

  • Structure-function relationships:

    • Determine high-resolution structures of Desulfatibacillum alkenivorans HtpX homolog

    • Map the conformational changes associated with substrate binding and catalysis

    • Identify structural adaptations specific to anaerobic environments

    • Develop structure-based models of substrate recognition and specificity

  • Translational applications:

    • Explore contributions to bioremediation of hydrocarbon-contaminated environments

    • Develop HtpX-based biosensors for monitoring anaerobic metabolic activities

    • Investigate potential as targets for controlling anaerobic bacteria in industrial or clinical settings

    • Engineer specialized variants for biotechnological applications requiring protease activity in anaerobic conditions

  • Comparative analysis across diverse anaerobes:

    • Expand studies to HtpX homologs from diverse anaerobic bacteria with different metabolic capabilities

    • Identify convergent adaptations in membrane protein quality control across unrelated anaerobes

    • Investigate unique features in extremophiles and specialized metabolic niches

    • Connect evolutionary patterns with ecological adaptations

These research directions would significantly advance our understanding of membrane protein quality control in anaerobic bacteria while generating valuable applications in environmental science and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.