Recombinant Desulfitobacterium hafniense Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Cobalamin Biosynthesis and Desulfitobacterium hafniense

Vitamin B12 (adenosylcobalamin) represents one of the most structurally complex small molecules in nature, exclusively synthesized by bacteria and archaea through an intricate biosynthetic pathway. The complete pathway involves approximately 30 genes encoding for proteins that catalyze a series of complex reactions to form the final vitamin B12 molecule . Among these enzymes, cobalamin synthase (CobS) plays a crucial role in the final assembly stages of the vitamin B12 molecule, acting as an adenosylcobinamide-GDP ribazoletransferase.

Desulfitobacterium hafniense is an anaerobic, gram-positive bacterium renowned for its ability to respire various organohalides, positioning it as an organism of significant interest in environmental bioremediation. This bacterium has been extensively studied for its involvement in O-demethylation reactions, which rely on cobalamin-dependent methyltransferases . The metabolic versatility of D. hafniense in utilizing cobalamin for various biochemical reactions makes it an important organism for understanding cobalamin metabolism and its related enzymes, including cobalamin synthase (CobS).

The ability to produce and study recombinant versions of these complex enzymes provides researchers with powerful tools to investigate their structure-function relationships and explore potential applications in biotechnology and bioremediation. This article focuses specifically on the current understanding of recombinant Desulfitobacterium hafniense cobalamin synthase (CobS), synthesizing available information and exploring its potential characteristics based on related proteins.

Functional Role in Vitamin B12 Biosynthesis

Cobalamin synthase (CobS) functions as a critical enzyme in the vitamin B12 biosynthetic pathway, specifically acting as an adenosylcobinamide-GDP ribazoletransferase or cobalamin-5'-phosphate synthase . In the well-characterized vitamin B12 salvage pathway of E. coli, CobS works in concert with other enzymes including CobU, CobT, and CobC to complete the assembly of the vitamin B12 molecule . The specific role of CobS involves catalyzing the attachment of the lower nucleotide loop to adenosylcobinamide-GDP, a crucial step in forming the complete vitamin B12 structure.

The functional importance of CobS lies in its ability to recognize specific substrates and catalyze precise reactions in the complex vitamin B12 biosynthetic pathway. Without functional CobS, organisms would be unable to complete the synthesis of vitamin B12, highlighting the essential nature of this enzyme in cobalamin metabolism.

The CobDH Protein: A Model for Understanding Cobalamin Binding

While direct information about CobS in D. hafniense is limited, significant insights can be gained from another cobalamin-binding protein from this organism. Research has identified and characterized a cobalamin-binding protein termed CobDH from D. hafniense DCB-2, which provides valuable information about how this organism utilizes cobalamin in its metabolic processes .

The crystal structure of CobDH has been determined at an impressive 1.5 Å resolution, revealing that the protein consists of 212 residues on a single polypeptide chain with a calculated molecular weight of approximately 22.5 kDa . Structurally, CobDH is composed of an N-terminal helix-bundle domain and a C-terminal Rossmann-fold domain, a common structural motif in nucleotide-binding proteins .

A notable feature of CobDH is its mode of cobalamin binding. The protein binds cobalamin in the base-off/His-on conformation, with the cobalamin coordinated to His102 as part of a conserved sequence motif (DxHxxG, residues 100-105) . This binding mode is similar to other cobalamin-binding domains that catalyze methyl-transfer reactions, suggesting a common mechanism for cobalamin-dependent catalysis across different proteins.

Functional Insights from CobDH

CobDH is implicated in O-demethylation reactions in D. hafniense, a process where methyl groups are transferred from phenyl methyl ethers to tetrahydrofolate via methyl-B12 intermediates . EPR and UV-Vis spectroscopic analyses have confirmed that CobDH binds cobalamin and have revealed that the CobDH-bound cobalamin cofactor can cycle between the cobalt(I), cobalt(II), and cobalt(III) oxidation states, which is essential for its catalytic function .

The genomic context of the CobDH gene suggests it is part of a three-component O-demethylase enzyme system. O-demethylase activity has been observed in D. hafniense strains DCB-2 and PCP-1, and studies have established O-demethylase activity for a related operon when expressed in E. coli . This information provides valuable context for understanding how D. hafniense utilizes cobalamin-dependent enzymes in its metabolism.

Table 2 summarizes the key features of CobDH based on the available research:

FeatureDescription
Protein Length212 amino acids
Molecular Weight~22.5 kDa
StructureN-terminal helix-bundle domain, C-terminal Rossmann-fold domain
Cobalamin BindingBase-off/His-on conformation, coordinated to His102
Conserved MotifDxHxxG (residues 100-105)
FunctionImplicated in O-demethylation, catalyzes methyl transfer
Oxidation StatesCobalamin cofactor cycles between Co(I), Co(II), and Co(III)

Expression Strategies and Challenges

The recombinant expression of cobalamin-related proteins represents a critical approach for studying their structure, function, and potential applications. The available research demonstrates successful recombinant expression of various cobalamin-binding proteins in E. coli, providing a blueprint for similar approaches with D. hafniense CobS.

The recombinant production of soluble CobDH from D. hafniense was successfully achieved in E. coli, demonstrating the feasibility of heterologous expression for these complex proteins . Similarly, recombinant CobS proteins from other organisms, such as H. walsbyi and T. yellowstonii, have been expressed in E. coli with N-terminal His tags, facilitating purification through affinity chromatography .

A significant challenge in the recombinant expression of cobalamin-binding proteins is ensuring proper cofactor incorporation. As noted in the case of CobDH, the protein was reconstituted during the purification process with exogenous methylcobalamin, as the heterologous E. coli host only synthesizes methylcobalamin when supplied with cobinamide . This highlights the importance of considering cofactor availability and incorporation when designing recombinant expression systems for cobalamin-related proteins.

Industrial Production of Vitamin B12

Recombinant cobalamin-related proteins, including CobS, hold significant potential for industrial applications, particularly in the production of vitamin B12 and its derivatives. The strong demand from the food, feed additive, and pharmaceutical industries has sparked interest in the use of bacteria for vitamin B12 production . Traditional industrial production of vitamin B12 relies on fermentation of Pseudomonas denitrificans and Propionibacterium freudenreichii, but these strains grow slowly and are difficult to engineer .

The engineering of the de novo vitamin B12 biosynthetic pathway in a fast-growing, genetically tractable species like E. coli represents an attractive alternative production platform . Recent research has demonstrated the successful metabolic engineering of E. coli for de novo biosynthesis of vitamin B12, achieving a remarkable increase in vitamin B12 yield by more than ~250-fold to 307.00 μg g-1 DCW through metabolic engineering and optimization of fermentation conditions . This achievement highlights the potential of recombinant approaches for vitamin B12 production.

In this context, a deeper understanding of D. hafniense CobS and its role in vitamin B12 biosynthesis could contribute to the development of more efficient recombinant production systems. The insights gained from studying this enzyme could inform strategies for optimizing the vitamin B12 biosynthetic pathway in industrial production strains.

Environmental Bioremediation Applications

D. hafniense and its cobalamin-dependent enzymes have significant potential applications in environmental bioremediation, particularly in the degradation of organohalide compounds. As noted in the research, organohalide-respiring bacteria like D. hafniense use cobalamin not only to support the dechlorination of halogenated compounds but also in the catalysis of demethylation reactions, leading to further mineralization of organic pollutants .

Understanding the role of CobS in the cobalamin biosynthetic pathway of D. hafniense could contribute to enhancing the bioremediation capabilities of this organism. By optimizing cobalamin production and utilization, it might be possible to improve the efficiency of D. hafniense in degrading environmental pollutants, particularly chlorinated compounds and phenyl methyl ethers.

Further exploration of the relationship between cobalamin metabolism and the degradation of organohalide compounds could reveal shared substrates between O-demethylases and reductive dehalogenases in D. hafniense . Such findings would be especially interesting for bioremediation strategies, potentially leading to the development of more effective approaches for the cleanup of contaminated environments.

Comparative Analysis with Other Cobalamin-Related Proteins

Comparative analysis of D. hafniense CobS with CobS proteins from other organisms and with other cobalamin-related proteins from D. hafniense, such as CobDH, would provide a more comprehensive understanding of cobalamin metabolism in this organism. This could reveal evolutionary relationships and functional adaptations related to the specific metabolic needs of D. hafniense.

Of particular interest would be the investigation of the functional relationships between the Dhaf0720-0722 gene products on both a biochemical and a structural level, as mentioned in the research . This would further explore the versatility of cobalamin-catalyzed enzymatic reactions in organohalide-respiring bacteria like D. hafniense.

Engineering for Enhanced Activity and Applications

Building on the understanding gained from basic research, future work could focus on engineering D. hafniense CobS and related proteins for enhanced activity, stability, or specificity. This could involve site-directed mutagenesis, directed evolution, or rational design approaches based on structural information.

Engineered variants of these proteins could be developed for specific applications, such as improved vitamin B12 production or enhanced bioremediation capabilities. The successful transfer of the complex biosynthetic pathway for vitamin B12 between organisms, as demonstrated in recent research , offers an encouraging example of how such engineering approaches could be applied to facilitate industrial production.

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to fulfill specific format requirements. Please indicate your desired format during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
cobS; DSY2116; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Desulfitobacterium hafniense (strain Y51)
Target Names
cobS
Target Protein Sequence
MPSMRKLWIALTFLTRIPLPQPEQVTSEEFTQSQHYYPLVGLILGGALWLALTLLLPHYP PLVTAALLLALELILTGGIHLDGLMDSMDGLLSARTPERMLEIMKDSHVGAFGALSAMVY LLLKFSLLAGLLALSSPLVPYLVLFMPILSRWIFLIGVHYFPYARAQGFGQGFHETSRQT RWLFLGEGLLLLFLTYWVLQWPGIAGFILATLFILLFTRKVSRLLGGLTGDLYGASIELS ELLFLLGAFPLLYP
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Desulfitobacterium hafniense* catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by combining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: dsy:DSY2116

STRING: 138119.DSY2116

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of cobalamin synthase (CobS) in D. hafniense?

Cobalamin synthase (CobS) in D. hafniense catalyzes one of the final steps in cobalamin (vitamin B12) biosynthesis. Based on genomic analysis, D. hafniense strains possess the ability to synthesize corrinoid cofactors de novo . Within the corrinoid biosynthetic pathway, CobS specifically facilitates the attachment of the lower nucleotide loop to the corrin ring, a critical step in forming the complete cobalamin molecule. This enzyme is particularly important in D. hafniense as the organism requires corrinoid cofactors for essential metabolic processes, including reductive dechlorination of halogenated organic compounds and O-demethylation reactions .

How does the structure of cobalamin-binding proteins in D. hafniense compare to other bacterial species?

The crystal structure of cobalamin-binding proteins in D. hafniense, such as CobDH, reveals a characteristic two-domain architecture composed of an N-terminal helix-bundle domain and a C-terminal Rossmann-fold domain. Despite relatively low sequence homology (28%) to other methyltransferases, the structural organization shows significant conservation . The cobalamin cofactor binds in the base-off/His-on conformation, with the central cobalt atom coordinated by a conserved histidine residue (His102) at a distance of 2.5 Å. This binding motif (DxHxxG, residues 100-105) is highly conserved among cobalamin-dependent methyltransferases . The distinctive structural features include:

  • A flexible linker region between domains (residues 83-89)

  • Specific interdomain interactions centered around Asp54 and Asn198

  • Hydrophobic interactions between domains involving Met46, Leu70, Ile108, and Met112

What techniques are used to express and purify recombinant D. hafniense cobalamin-related proteins?

Recombinant production of soluble cobalamin-binding proteins from D. hafniense has been successfully achieved in E. coli expression systems. The general methodology includes:

  • Cloning the target gene into an appropriate expression vector

  • Transformation into E. coli host cells

  • Induction of protein expression under controlled conditions

  • Cell lysis and initial purification steps

  • Reconstitution with exogenous methylcobalamin during purification

  • Verification of successful reconstitution by observing characteristic pink coloration, indicating cob(III)alamin binding

Purification typically involves affinity chromatography followed by size exclusion chromatography. The resulting purified protein has been confirmed by SDS-PAGE analysis, showing the expected molecular weight (approximately 22.5 kDa for CobDH) .

How do cobalamin riboswitches regulate corrinoid metabolism in D. hafniense?

D. hafniense employs an extensive riboswitch-mediated regulatory network for corrinoid metabolism. Genome analysis of three D. hafniense strains (Y51, DCB-2, and TCE1) has revealed a remarkable diversity of 18 distinct cobalamin riboswitches (Cbl-RS) that regulate genes involved in corrinoid biosynthesis and transport . These RNA regulatory elements exhibit diversity in their structural components and varying affinities toward adenosylcobalamin.

The cobalamin riboswitches in D. hafniense operate primarily at the transcriptional level, as evidenced by:

  • The presence of typical transcription terminators in most expression platforms

  • Significantly longer expression platforms (66-277 nucleotides) compared to translational riboswitches like the E. coli btuB riboswitch (34 nucleotides)

  • Adenosylcobalamin-induced in vivo repression of RNA synthesis of the downstream genes

Most D. hafniense Cbl-RS contain both core and peripheral regions, though two (RS07 and RS18) display only the core region without the peripheral region bulging from P7. Notably, these riboswitches lack the P12 structure and, in most cases, P9 as well, distinguishing them from the E. coli btuB riboswitch structure .

What is the relationship between oxidation states of cobalamin and protein function in D. hafniense?

Spectroscopic analyses of cobalamin-binding proteins in D. hafniense reveal that the bound cobalamin cofactor can cycle between multiple oxidation states:

Oxidation StateFormSpectroscopic CharacteristicsFunctional Implications
Cobalt(I)Cob(I)alaminNucleophilic "super-reduced" formActive in methyl group acceptance
Cobalt(II)Cob(II)alaminParamagnetic, EPR-activeIntermediate state during catalysis
Cobalt(III)Cob(III)alaminDiamagnetic, bright pink colorMethylated form, participates in methyl transfer
Cobalt(III) superoxideCob(III)alamin superoxideSpecific EPR signatureIndicates oxygen binding to fully oxidized cofactor

EPR and UV-Vis spectroscopic analyses confirm that proteins like CobDH can accommodate all three oxidation states of cobalamin, which is essential for their catalytic function in methyl transfer reactions . The ability to cycle between these oxidation states is crucial for catalytic activity during O-demethylation reactions, where methyl groups are transferred from phenyl methyl ethers to tetrahydrofolate via methyl-B12 intermediates .

How does the genomic context influence the expression and function of cobalamin synthase in D. hafniense?

The genomic organization surrounding cobalamin biosynthetic genes in D. hafniense provides critical insights into their regulation and functional relationships. In D. hafniense, cobalamin-related genes are often organized in operons or gene clusters that are regulated by cobalamin riboswitches. For instance, the Dhaf0720-0722 gene products appear to form a three-component O-demethylase enzyme system .

Key aspects of the genomic context include:

  • Operon structure and co-regulated genes

  • Presence of regulatory elements (18 distinct cobalamin riboswitches)

  • Conservation of gene clusters across different D. hafniense strains (Y51, DCB-2, TCE1)

  • Correlation between genomic context and functional relationships

This genomic organization suggests that cobalamin synthesis genes, including cobS, are co-regulated with genes involved in corrinoid transport and utilization, reflecting the integrated nature of corrinoid metabolism in D. hafniense.

What crystallization conditions are optimal for structural studies of D. hafniense cobalamin-binding proteins?

Successful crystallization of cobalamin-binding proteins from D. hafniense has been achieved using microseeding techniques. The general methodology includes:

  • Initial crystallization screening to identify preliminary crystallization conditions

  • Microseeding with small crystals obtained from initial screening

  • Optimization of crystallization conditions to grow large rectangular crystals suitable for X-ray diffraction

  • Data collection at synchrotron radiation sources (e.g., Diamond Light Source beamline I02)

  • Processing diffraction data to resolutions of 1.5 Å or better

For specific proteins like CobDH, crystals were successfully grown and diffracted to a resolution of 1.5 Å, allowing for detailed structural analysis of cobalamin binding and protein architecture . The crystallization process must account for the oxidation state of the cobalamin cofactor, which may change during crystallization due to photolysis or other factors.

How can researchers design experiments to investigate the interaction between cobalamin riboswitches and their ligands in D. hafniense?

To investigate interactions between cobalamin riboswitches and their ligands in D. hafniense, researchers can employ a combination of computational and experimental approaches:

  • Secondary Structure Prediction:

    • Utilize programs like Mfold to predict the secondary structure of RNA elements

    • Identify conserved structural elements in the aptamer domain

  • In-line Probing:

    • Monitor RNA structure changes upon ligand binding

    • Quantify the affinity of different riboswitch variants toward adenosylcobalamin

  • In Vivo Repression Assays:

    • Measure adenosylcobalamin-induced repression of RNA synthesis

    • Analyze the effect on downstream gene expression

  • Sequence Alignment and Comparative Analysis:

    • Align cobalamin riboswitch sequences across different strains

    • Identify conserved and variable regions that may influence binding affinity

These approaches have revealed that D. hafniense cobalamin riboswitches display various affinities toward adenosylcobalamin, which likely relates to their specific roles in regulating different aspects of corrinoid metabolism .

What spectroscopic methods are most informative for characterizing recombinant D. hafniense cobalamin synthase and related proteins?

Multiple spectroscopic techniques provide complementary information about recombinant cobalamin-binding proteins from D. hafniense:

Spectroscopic MethodInformation ObtainedApplication to D. hafniense Proteins
UV-Visible SpectroscopyOxidation state of cobalaminConfirmation of reconstitution; monitoring of cobalt oxidation states
Electron Paramagnetic Resonance (EPR)Paramagnetic species detectionIdentification of cob(II)alamin and cob(III)alamin superoxide species
X-ray CrystallographyAtomic-resolution structureDetermination of protein fold, cobalamin binding site, and coordination geometry
Circular DichroismSecondary structure contentAssessment of protein folding and stability

EPR spectroscopy has been particularly valuable in confirming cobalamin binding and revealing the presence of cob(III)alamin superoxide in proteins like CobDH, indicating oxygen binding to the fully oxidized cofactor . The combination of these spectroscopic methods provides a comprehensive characterization of the structural and electronic properties of cobalamin-binding proteins in D. hafniense.

How can understanding D. hafniense cobalamin synthesis contribute to bioremediation strategies?

D. hafniense is an obligate anaerobe capable of reductively dechlorinating halogenated organic compounds, a process requiring corrinoid cofactors in reductive dehalogenases. Understanding cobalamin synthesis in this organism has significant implications for bioremediation:

  • Enhanced Dechlorination Capacity:

    • Optimization of corrinoid cofactor availability can improve the efficiency of organohalide respiration

    • Engineering strains with enhanced cobalamin synthesis could accelerate bioremediation of contaminated sites

  • Synergistic Microbial Relationships:

    • Corrinoid-producing bacteria like D. hafniense can support corrinoid-auxotroph organohalide-respiring bacteria in mixed communities

    • Understanding how these organisms regulate corrinoid synthesis and export is crucial for designing effective microbial consortia

  • Substrate Range Expansion:

    • Investigation of shared substrates between O-demethylases and reductive dehalogenases could identify new target compounds for bioremediation

    • The versatility of cobalamin-catalyzed enzymatic reactions in organohalide-respiring bacteria may enable degradation of recalcitrant pollutants

This research area represents a promising frontier in environmental biotechnology, as it could lead to more efficient biological treatment systems for sites contaminated with organohalides.

What are the challenges in expressing fully functional recombinant D. hafniense cobalamin synthase in heterologous systems?

Expressing fully functional recombinant cobalamin synthase from D. hafniense in heterologous systems presents several challenges:

  • Cofactor Availability:

    • Heterologous hosts like E. coli only synthesize methylcobalamin when supplied with cobinamide

    • Reconstitution with exogenous methylcobalamin during purification is necessary

  • Protein Folding and Stability:

    • Ensuring proper folding of the complex two-domain architecture

    • Maintaining the integrity of the cobalamin binding site

  • Partner Protein Interactions:

    • Cobalamin synthase and other methyltransferases require additional proteins or protein domains to bind substrates and products

    • Absence of native interaction partners in heterologous systems may limit functionality

  • Anaerobic Expression Conditions:

    • D. hafniense is an obligate anaerobe, and expression may require anaerobic conditions

    • Oxidation state management of the cobalamin cofactor during expression and purification

Addressing these challenges requires careful optimization of expression conditions, consideration of appropriate host systems, and potentially co-expression with partner proteins to achieve fully functional recombinant enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.