Recombinant Desulfitobacterium hafniense Glycerol-3-phosphate acyltransferase 1 (plsY1)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant PlsY1 is expressed in Escherichia coli with an N-terminal or C-terminal hexahistidine (His6) tag for purification . The protein is membrane-bound and belongs to the acyltransferase family, specifically functioning as a glycerol-3-phosphate acyltransferase (GPAT) .

Functional Role in Lipid Metabolism

PlsY1 is essential for:

  • Membrane biogenesis: Synthesizes phosphatidic acid (PA), a precursor for phospholipids and TAG .

  • Energy storage: TAG serves as an energy reservoir during bacterial dormancy .

  • Stress adaptation: Upregulated during metabolic shifts in D. hafniense, such as organohalide respiration .

Production and Purification

Recombinant PlsY1 is produced using plasmid vectors (e.g., pET22b+) in E. coli BL21(DE3) . Key steps include:

  1. Induction: IPTG (80 µM) triggers T7 promoter-driven expression.

  2. Purification: Nickel-affinity chromatography (Ni-NTA column) under native conditions .

  3. Elution: Achieved with 250 mM imidazole buffer, yielding >90% pure protein .

Stability Considerations:

  • Repeated freeze-thaw cycles degrade the enzyme.

  • Short-term storage at 4°C in Tris/PBS buffer with 6% trehalose maintains activity .

Comparative Analysis with PlsY2

D. hafniense encodes a paralog, PlsY2 (UniProt: Q24VA3), which shares 35% sequence identity with PlsY1 but differs in substrate specificity :

FeaturePlsY1PlsY2
Gene LocusDSY1287DSY2250
Subcellular LocalizationMembrane-boundMembrane-bound
Preferred Acyl DonorSaturated fatty acids (C16:0, C18:0)Unsaturated fatty acids (C16:1, C18:1)
Physiological RolePrimary TAG synthesisSecondary lipid remodeling

Research Applications

  • Biochemical assays: Study lipid biosynthesis pathways .

  • Drug target exploration: Inhibitors targeting PlsY1 could disrupt mycobacterial persistence (e.g., Mycobacterium tuberculosis) .

  • Structural studies: Insights into membrane protein solubilization and catalysis .

Outstanding Questions

  • Substrate specificity: Detailed kinetic parameters (e.g., KmK_m, VmaxV_{max}) remain uncharacterized .

  • Regulatory mechanisms: How is PlsY1 expression modulated during metabolic shifts in D. hafniense?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
plsY1; DSY1287; Glycerol-3-phosphate acyltransferase 1; Acyl-PO4 G3P acyltransferase 1; Acyl-phosphate--glycerol-3-phosphate acyltransferase 1; G3P acyltransferase 1; GPAT 1; Lysophosphatidic acid synthase 1; LPA synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Desulfitobacterium hafniense (strain Y51)
Target Names
plsY1
Target Protein Sequence
MKLASKEAGMIDLFMILGAYLLGGMSTGYYLVKLWRQEDVRNQGSGATGATNAGRVLGKK GFLLTLMGDALKGALAPALSMHFNLSLTTLILCLIAGVAGHIWPLQLGLRGGKGVAPALG GILVVDPMLASAAAGVFLFVLALTRQFTLSGLAAILGAPILSLIMARPFEQSAGLAVLAI FILLAHRKNIREMLNKSSQRRR
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor but does not utilize acyl-CoA or acyl-ACP.
Database Links

KEGG: dsy:DSY1287

STRING: 138119.DSY1287

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase 1 (plsY1) and what is its function in Desulfitobacterium hafniense?

Glycerol-3-phosphate acyltransferase 1 (plsY1) is an enzyme that catalyzes the first step in phospholipid biosynthesis in Desulfitobacterium hafniense. Specifically, it transfers an acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate, forming lysophosphatidic acid (LPA), a precursor for membrane phospholipid synthesis. The enzyme is also known by several synonyms including Acyl-PO4 G3P acyltransferase 1, G3P acyltransferase 1, and GPAT 1, with an EC number of 2.3.1.n3 . In D. hafniense, this enzyme is essential for cell membrane formation and integrity, particularly important given the organism's strict anaerobic nature and its ability to conserve energy through organohalide respiration .

What are the structural characteristics of recombinant D. hafniense plsY1?

The recombinant D. hafniense plsY1 is typically produced as a partial protein with high purity (>90%) . The protein is commonly available in liquid form containing glycerol as a stabilizer. While the complete structural details aren't specified in the current data, the enzyme belongs to the acyltransferase family. The recombinant protein can be produced in various expression systems including E. coli, yeast, baculovirus, or mammalian cells, which may affect post-translational modifications and structural characteristics . The gene encoding this protein in D. hafniense strain Y51 corresponds to UniProt accession number Q24Y16 .

How does D. hafniense plsY1 function differ from similar enzymes in other bacterial species?

While the specific data on comparative enzyme function is limited in the provided sources, D. hafniense plsY1 likely exhibits adaptations reflective of the organism's strict anaerobic lifestyle and specialized metabolism. Unlike aerobic bacteria, D. hafniense has evolved enzymatic systems optimized for functioning in oxygen-depleted environments. Its plsY1 enzyme may have unique substrate specificities or regulatory mechanisms that allow efficient membrane lipid synthesis under the reducing conditions where this bacterium thrives. D. hafniense's versatile energy metabolism, capable of utilizing various electron donors (lactate, pyruvate, hydrogen) and acceptors (fumarate, ClOHPA, PCE), suggests its plsY1 enzyme may have adapted to function optimally across these diverse metabolic states .

What are the optimal expression systems for producing recombinant D. hafniense plsY1?

Recombinant D. hafniense plsY1 can be successfully expressed in multiple host systems including E. coli, yeast, baculovirus, or mammalian cells . The choice of expression system depends on the research requirements:

  • E. coli expression system: Most commonly used due to rapid growth, high protein yields, and cost-effectiveness. Optimal for structural studies requiring non-glycosylated protein.

  • Yeast expression system: Provides eukaryotic post-translational modifications while maintaining relatively high yields. Suitable for functional studies requiring proper protein folding.

  • Baculovirus expression system: Offers advantages for proteins that may be toxic to bacterial hosts or require specific eukaryotic modifications.

  • Mammalian cell expression: Provides the most authentic post-translational modifications but with lower yields and higher costs.

For fundamental biochemical characterization, the E. coli system typically offers the best balance of yield and functionality for this bacterial enzyme.

What purification strategies yield the highest purity and activity for recombinant plsY1?

For obtaining high-purity (>90%) recombinant plsY1 with optimal activity, a multi-step purification strategy is recommended:

  • Affinity chromatography: If the recombinant protein is tagged (commonly with His-tag), immobilized metal affinity chromatography (IMAC) provides effective initial purification.

  • Ion exchange chromatography: As a secondary step to remove contaminants with similar affinity but different charge properties.

  • Size exclusion chromatography: As a polishing step to achieve >90% purity while maintaining the native conformation of the enzyme.

Throughout purification, it's critical to maintain the protein in a stabilizing buffer containing glycerol, as indicated in the product specifications . The final purified product should be stored in a Tris-based buffer with 50% glycerol to maintain stability and enzymatic activity .

What are the optimal storage conditions to maintain plsY1 activity long-term?

Based on the product specifications, recombinant D. hafniense plsY1 requires specific storage conditions to maintain long-term stability and enzymatic activity:

  • Short-term storage (up to one week): Store working aliquots at 4°C in a Tris-based buffer containing 50% glycerol .

  • Regular storage: Maintain at -20°C in the same buffer formulation .

  • Long-term storage: For extended preservation, store at -80°C .

It's important to note that repeated freezing and thawing cycles are detrimental to protein stability and should be avoided . Therefore, preparing single-use aliquots before freezing is highly recommended. Additionally, the presence of glycerol in the storage buffer is essential as it prevents ice crystal formation during freezing and helps maintain the protein's native conformation.

How does freeze-thaw cycling affect plsY1 activity and what methods can minimize activity loss?

Repeated freeze-thaw cycles can significantly reduce plsY1 enzymatic activity through several mechanisms including protein denaturation, aggregation, and oxidation. To minimize activity loss:

  • Prepare single-use aliquots: Divide purified protein into small volumes based on typical experimental needs before freezing.

  • Use proper buffer components: Ensure the storage buffer contains 50% glycerol as indicated in the product specifications .

  • Control freezing and thawing rates: Slow freezing and quick thawing in a water bath (not above 25°C) help preserve protein structure.

  • Add stabilizing agents: Besides glycerol, consider adding reducing agents like DTT or β-mercaptoethanol if the enzyme contains critical cysteine residues.

  • Working aliquot strategy: Keep a small working aliquot at 4°C for up to one week for ongoing experiments, reducing the need for repeated freezing and thawing .

What in vitro assay systems best measure plsY1 enzymatic activity?

For measuring D. hafniense plsY1 enzymatic activity in vitro, several assay systems can be employed:

  • Radiometric assay: Using 14C-labeled acyl-phosphate or glycerol-3-phosphate substrates to quantify product formation through scintillation counting. This approach offers high sensitivity but requires radioisotope handling facilities.

  • Spectrophotometric coupled assay: Coupling LPA production to NAD+/NADH conversion through secondary enzymes, allowing continuous monitoring at 340 nm.

  • HPLC-based assay: Separating and quantifying reaction products (lysophosphatidic acid) using reverse-phase HPLC with appropriate detection methods.

  • Mass spectrometry: LC-MS/MS for precise identification and quantification of reaction products, particularly useful for characterizing substrate specificity.

When designing these assays, it's crucial to consider the anaerobic nature of D. hafniense and potentially conduct reactions under reduced oxygen conditions to mimic the enzyme's native environment .

How can plsY1 be used to study membrane phospholipid biosynthesis pathways in anaerobic bacteria?

Recombinant D. hafniense plsY1 provides a valuable tool for investigating membrane phospholipid biosynthesis in anaerobic bacteria through several research approaches:

  • Comparative biochemistry: Contrasting kinetic parameters of plsY1 from D. hafniense with orthologs from other bacterial species to identify adaptations specific to anaerobic metabolism.

  • Substrate specificity analysis: Determining preferences for different acyl-phosphate donors to understand membrane composition regulation under anaerobic conditions.

  • Inhibitor screening: Identifying selective inhibitors of plsY1 that could serve as tools for studying the importance of specific lipids in anaerobic bacterial physiology.

  • Reconstitution experiments: Incorporating purified plsY1 into liposomes or nanodiscs to study activity in a membrane-like environment.

  • Metabolic flux analysis: Using isotope-labeled precursors to track carbon flow through the phospholipid biosynthesis pathway in D. hafniense under different growth conditions.

This enzyme is particularly interesting for studying how strict anaerobes like D. hafniense regulate membrane composition in response to diverse electron donors and acceptors used in its versatile energy metabolism .

How does plsY1 activity correlate with D. hafniense growth under different metabolic conditions?

The relationship between plsY1 activity and D. hafniense growth appears to vary significantly depending on the metabolic conditions. Although the search results don't directly address plsY1 activity, we can draw parallels from the comprehensive metabolic studies on D. hafniense:

  • Electron donor influence: D. hafniense strains show different growth patterns depending on the electron donor (lactate, pyruvate, or hydrogen) . These differences likely affect membrane composition requirements and consequently plsY1 activity levels.

  • Respiratory vs. fermentative metabolism: The bacterium exhibits distinct behaviors under respiratory conditions (with fumarate, ClOHPA, or PCE as electron acceptors) compared to fermentative conditions (pyruvate-only) , suggesting different membrane lipid requirements.

  • Strain-specific variations: Different strains (DCB-2, TCE1, Y51) show variations in metabolic capabilities , potentially reflecting differences in phospholipid biosynthesis regulation.

The complex I-like enzyme inhibition studies with rotenone showed that D. hafniense growth is completely inhibited when using organic electron donors (lactate, pyruvate) but not affected when using hydrogen , indicating a potential metabolic connection between energy generation and membrane biogenesis pathways.

What is the relationship between plsY1 and the organohalide respiration pathways in D. hafniense?

While the direct relationship between plsY1 and organohalide respiration (OHR) pathways isn't explicitly detailed in the search results, we can infer potential connections:

  • Membrane integrity for respiratory complexes: OHR involves membrane-bound dehalogenase enzymes that require appropriate phospholipid environments for optimal function. plsY1, as a key enzyme in phospholipid biosynthesis, likely plays a crucial role in maintaining proper membrane composition.

  • Adaptation to electron acceptors: D. hafniense can use various halogenated compounds (ClOHPA, PCE) as electron acceptors . These compounds may influence membrane properties, necessitating adjustments in phospholipid composition regulated through plsY1 activity.

  • Metabolic integration: The inhibition studies with rotenone revealed that D. hafniense strain DCB-2 in La/ClOHPA conditions (using lactate as electron donor and ClOHPA as acceptor for OHR) shows growth inhibition , suggesting a potential link between central metabolism, membrane biogenesis, and OHR.

  • Strain-specific adaptive strategies: Different D. hafniense strains (DCB-2, TCE1) show varying responses to metabolic inhibitors when growing on the same organohalide electron acceptors , potentially reflecting differences in membrane composition optimization.

How can isotope labeling be used with plsY1 to track phospholipid biosynthesis in D. hafniense?

Isotope labeling approaches can provide valuable insights into phospholipid biosynthesis pathways involving plsY1 in D. hafniense:

  • 13C-labeled substrates: Using 13C-labeled glycerol-3-phosphate or acyl-phosphate donors to track carbon incorporation into phospholipids, allowing for time-resolved analysis of membrane lipid turnover.

  • 2H (deuterium) labeling: Incorporating deuterated substrates to examine hydrogen exchange during catalysis, providing mechanistic insights into the acyltransferase reaction.

  • Pulse-chase experiments: Introducing labeled precursors for a short period followed by unlabeled compounds to track phospholipid maturation and turnover rates.

  • Coupled with mass spectrometry: LC-MS/MS analysis of labeled phospholipids can reveal detailed information about acyl chain distributions and phospholipid subspecies under different growth conditions.

  • Metabolic flux analysis: Combining isotope labeling with computational modeling to quantify flux through phospholipid biosynthesis pathways relative to other metabolic processes in D. hafniense.

This approach is particularly valuable for understanding how D. hafniense adapts its membrane composition when transitioning between different electron donors (lactate, pyruvate, hydrogen) and acceptors (fumarate, ClOHPA, PCE) as observed in growth studies .

What techniques can be used to investigate potential inhibitors of D. hafniense plsY1 for antimicrobial development?

Several sophisticated techniques can be employed to investigate potential inhibitors of D. hafniense plsY1:

  • High-throughput screening (HTS): Using fluorescence-based or coupled enzymatic assays to screen chemical libraries for compounds that inhibit plsY1 activity.

  • Structure-based drug design: If crystal structures become available, computational approaches like molecular docking and virtual screening can identify molecules with high binding affinity to the enzyme's active site.

  • Fragment-based drug discovery: Identifying small chemical fragments that bind to different regions of plsY1 and subsequently linking them to create potent, selective inhibitors.

  • Differential scanning fluorimetry (DSF): Measuring changes in protein thermal stability upon inhibitor binding to identify compounds that interact with plsY1.

  • Surface plasmon resonance (SPR): Quantifying binding kinetics between plsY1 and potential inhibitors in real-time.

  • Whole-cell assays: Testing promising inhibitors against D. hafniense cultures under various growth conditions (as described in the rotenone inhibition studies ) to assess antimicrobial efficacy.

  • Lipidomic analysis: Examining changes in phospholipid profiles upon inhibitor treatment to confirm on-target effects and understand membrane composition alterations.

What are common challenges in expressing and purifying active D. hafniense plsY1 and how can they be addressed?

Researchers working with recombinant D. hafniense plsY1 may encounter several challenges:

ChallengePotential Solutions
Low expression yields- Optimize codon usage for the host organism
- Try different expression vectors and promoters
- Adjust induction conditions (temperature, inducer concentration, duration)
- Consider fusion tags that enhance solubility (MBP, SUMO)
Protein insolubility- Express at lower temperatures (16-20°C)
- Include solubility enhancers in lysis buffer (glycerol, mild detergents)
- Try different cell lysis methods
- Consider refolding from inclusion bodies if necessary
Loss of activity during purification- Maintain reducing conditions throughout purification
- Include glycerol in all buffers as indicated in product specifications
- Minimize purification steps and time
- Consider anaerobic purification given D. hafniense's strict anaerobic nature
Proteolytic degradation- Include protease inhibitors in lysis and purification buffers
- Use protease-deficient expression strains
- Optimize purification speed to minimize exposure to proteases
Storage instability- Store in appropriate conditions (-20°C or -80°C with 50% glycerol)
- Prepare single-use aliquots to avoid freeze-thaw cycles
- Consider lyophilization for very long-term storage

How can researchers troubleshoot inconsistent enzymatic activity in plsY1 assays?

When encountering inconsistent enzymatic activity in plsY1 assays, researchers should systematically investigate:

  • Enzyme quality assessment:

    • Verify protein purity (>90% as specified ) using SDS-PAGE

    • Check for proteolytic degradation with Western blotting

    • Evaluate protein folding using circular dichroism or fluorescence spectroscopy

  • Reaction conditions optimization:

    • Test different pH values (typically 6.5-8.0 for bacterial enzymes)

    • Optimize buffer composition (ionic strength, divalent cations)

    • Ensure anaerobic conditions given D. hafniense's strict anaerobic nature

  • Substrate considerations:

    • Verify substrate quality and purity

    • Optimize substrate concentrations through Michaelis-Menten kinetics

    • Test different acyl-phosphate donors to identify preferred substrates

  • Assay system validation:

    • Include positive controls with known activity

    • Prepare fresh reagents for each experiment

    • Ensure detection method is within linear range

  • Environmental factors:

    • Control temperature fluctuations during assays

    • Protect light-sensitive components from exposure

    • Consider microanaerobic conditions to mimic D. hafniense's natural environment

A systematic approach to these factors should help identify the source of inconsistency and establish reliable assay conditions.

What are the most promising future research directions for D. hafniense plsY1?

Several promising research directions for D. hafniense plsY1 include:

  • Structural biology: Determining the three-dimensional structure of plsY1 through X-ray crystallography or cryo-EM would provide insights into substrate binding and catalytic mechanism.

  • Comparative biochemistry: Systematic comparison with plsY1 enzymes from other bacteria, particularly those with different respiratory capabilities, could reveal adaptations specific to anaerobic metabolism.

  • Systems biology integration: Investigating how plsY1 expression and activity correlate with the diverse metabolic states observed in D. hafniense to understand regulatory networks linking energy metabolism and membrane biogenesis.

  • Biotechnological applications: Exploring the enzyme's potential for biocatalysis in the synthesis of specialized phospholipids or lipid-based nanomaterials.

  • Antimicrobial development: Targeting phospholipid biosynthesis in environmental dehalogenating bacteria could lead to selective agents for controlling these organisms in specific contexts.

  • Synthetic biology approaches: Engineering plsY1 with modified substrate specificity could enable production of novel phospholipids with unique properties.

These directions would build upon the current knowledge of D. hafniense's versatile metabolism and the availability of recombinant plsY1 to expand our understanding of bacterial phospholipid biosynthesis in anaerobic environments.

How does understanding plsY1 function contribute to broader knowledge of bacterial adaptation to anaerobic environments?

Understanding plsY1 function in D. hafniense provides valuable insights into bacterial adaptation to anaerobic environments:

  • Membrane adaptations: Phospholipid composition significantly influences membrane properties like fluidity, permeability, and protein integration. plsY1's substrate preferences likely reflect adaptations to maintain optimal membrane function under anaerobic conditions.

  • Metabolic integration: D. hafniense shows remarkable metabolic versatility, growing with different electron donors and acceptors . plsY1 activity must be coordinated with these metabolic shifts to ensure appropriate membrane composition for each energetic mode.

  • Environmental stress responses: Anaerobic bacteria face unique challenges including fluctuating redox potential and limited energy yield. plsY1's regulation may reveal mechanisms by which these organisms balance membrane biogenesis with energy conservation.

  • Evolutionary insights: Comparing plsY1 from D. hafniense with orthologs from facultative anaerobes could identify critical adaptations that enabled strict anaerobic lifestyles to evolve.

  • Ecological significance: As key players in environmental dehalogenation processes, understanding how D. hafniense optimizes membrane composition through plsY1 activity could improve bioremediation strategies for halogenated pollutants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.