Recombinant Desulfitobacterium hafniense Large-conductance mechanosensitive channel (mscL)

What is the structural organization of the Desulfitobacterium hafniense MscL protein?

The Large-Conductance Mechanosensitive Channel (MscL) from Desulfitobacterium hafniense forms a homopentameric structure with each subunit containing two transmembrane regions. The protein consists of 150 amino acids with the sequence: MWKEFKEFAMKGNVIDLAVGVIIGGAFGKIVTSLVNDVIMPLVGLLLGQMDFSNAFITLGKGDFATIAEAQAAKVPTLNYGLFINNVVDFLIIAFTIFIVIKQINRFNRKKEVKEEVAEEATKPCPYCYVEIHKEATRCPHCTSVLESP . This structure enables the channel to respond to mechanical forces in the lipid bilayer, operating through a gating mechanism triggered by hydrophobic mismatch and changes in membrane curvature or transbilayer pressure profiles .

What physiological role does the MscL protein serve in Desulfitobacterium hafniense?

The primary physiological function of MscL in D. hafniense, similar to other bacterial species, is to protect against osmotic cell lysis during environmental stress conditions . During stationary phase growth and particularly during osmotic shock, the channel protein is upregulated to prevent cellular damage . This mechanosensitive channel opens in response to stretch forces in the lipid bilayer, allowing rapid efflux of cytoplasmic solutes when bacteria experience hypoosmotic stress, thereby preventing cell rupture by equilibrating osmotic pressure across the membrane .

How does the D. hafniense MscL compare to mechanosensitive channels in other bacterial species?

While the basic function of MscL proteins is conserved across bacterial species, the D. hafniense MscL has unique structural features compared to more well-characterized channels from model organisms like E. coli. D. hafniense is an anaerobic, spore-forming bacterium from the Firmicutes phylum with unique metabolic capabilities including organohalide respiration . Its MscL may have adapted to function optimally in its specialized ecological niche, which often includes polluted soils and sediments with varying osmotic conditions . The protein sequence contains cysteine residues (PCPYCYVEIHKEATRCPHCTSVLESP) near the C-terminus that may be involved in redox sensing or metal coordination, potentially linking mechanosensation to the organism's redox metabolism in anaerobic environments .

What are the recommended expression systems for recombinant production of D. hafniense MscL?

For recombinant expression of D. hafniense MscL, researchers should consider the following expression systems:

• Mammalian expression systems: Particularly effective for membrane proteins like MscL, as demonstrated in protocols for other recombinant proteins from D. hafniense . Expi293 Expression system (using HEK293 cells) has been successfully employed for expressing recombinant proteins from similar organisms .

• E. coli-based systems: Using vectors like pASK-IBA3C with appropriate promoters has been effective for expressing other membrane proteins from D. hafniense . This approach is more economical but may require optimization for proper folding.

• Expression vector selection: Vectors containing modified human cytomegalovirus (CMV) promoters and enhancers for transient expression, similar to the pMH expression vector described in recombinant protein studies .

The recommended workflow includes gene amplification, cloning into an expression vector, transformation into the host system, expression testing, large-scale production, and purification . For membrane proteins like MscL, detergent screening is a critical step to maintain protein stability and functionality during purification.

What purification strategies yield functional D. hafniense MscL protein?

Purification of functional recombinant D. hafniense MscL requires a carefully designed protocol:

• Chromatography sequence:

  • Initial capture using affinity chromatography (if tagged) or ion exchange chromatography

  • For C-terminally tagged constructs (e.g., with human Fc), Protein A affinity chromatography using HiTrap Protein A HP columns is effective

  • For untagged proteins, cation exchange chromatography using RESOURCE S columns, equilibrated with 50 mM MES, 100 mM NaCl, pH 6, and eluted with a linear gradient to 500 mM NaCl

• Size exclusion polishing step: Using a HiLoad 26/600 Superdex 75 pg column in 10 mM PBS to achieve high purity and remove aggregates

• Membrane protein considerations:

  • Extraction from membranes requires careful detergent selection

  • Maintaining the pentameric structure during purification is critical for function

  • Buffer conditions must be optimized to prevent denaturation

• Validation methods:

  • N-terminal sequencing using Edman degradation to confirm protein identity

  • Mass spectrometry for protein integrity verification

  • Functional assays to confirm channel activity

How can researchers incorporate non-canonical amino acids into recombinant D. hafniense MscL for structure-function studies?

Incorporation of non-canonical amino acids (ncAAs) into recombinant D. hafniense MscL can be achieved through several strategies:

• Site-specific incorporation using amber suppression:

  • Introduce TAG stop codons at positions of interest in the MscL gene sequence

  • Co-express an orthogonal aminoacyl-tRNA synthetase/tRNA pair, such as the Methanocaldococcus jannaschii tyrosyl-RS/tRNATyr pair that has been modified to recognize ncAAs

  • Supplement growth media with the desired ncAA

• Cell-free expression systems:

  • For difficult membrane proteins like MscL, cell-free systems offer advantages

  • Deploy chemically aminoacylated tRNAs with the desired ncAA

  • The deprotected acylated tRNA and MscL mRNA containing a suppression codon can be combined in vitro

• Critical controls:

  • Test for "read-through" by including controls with cRNA containing a suppression codon co-injected with non-aminoacylated tRNA

  • Verify incorporation using mass spectrometry

  • Assess structural integrity of modified proteins using circular dichroism

This approach allows researchers to introduce spectroscopic probes, crosslinking agents, or other functional groups at specific sites within the MscL structure to investigate gating mechanisms, conformational changes, and lipid interactions .

How can researchers measure the mechanosensitive properties of recombinant D. hafniense MscL?

Measuring the mechanosensitive properties of recombinant D. hafniense MscL requires specialized techniques:

• Patch-clamp electrophysiology:

  • Reconstitute purified MscL into liposomes or directly express in giant spheroplasts

  • Apply negative pressure to the patch pipette to create membrane tension

  • Record channel currents at different membrane tensions

  • Analysis parameters should include:

    • Channel open probability vs. membrane tension

    • Single-channel conductance

    • Opening and closing kinetics

    • Sub-conductance states during gating transitions

• Fluorescence-based assays:

  • Reconstitute MscL in liposomes loaded with fluorescent dyes

  • Apply osmotic shock or membrane-perturbing agents

  • Monitor dye release as a measure of channel activity

  • This approach allows higher throughput screening of channel variants or conditions

• Isothermal titration calorimetry (ITC):

  • Can be used to study interactions between MscL and lipids or potential modulators

  • Similar to methods described for other recombinant proteins, using a MicroCal PEAQ-ITC instrument at 25°C

  • Data should be fitted to appropriate binding models

• Structural studies:

  • Cryo-electron microscopy of purified protein in nanodiscs

  • Solid-state NMR of reconstituted channels

  • These techniques can capture different conformational states of the channel

What approaches are effective for studying the role of D. hafniense MscL in osmotic stress response in vivo?

To study the in vivo role of D. hafniense MscL in osmotic stress response:

• Genetic manipulation strategies:

  • Create knockout mutants of the mscL gene in D. hafniense using techniques similar to those used for transposon studies in this organism

  • Complement with wild-type or mutant versions of the channel to assess functional recovery

  • Consider the genetic context, as D. hafniense has a complex genome with potential redundancy in osmotic response mechanisms

• Hypoosmotic shock survival assays:

  • Culture cells to mid-log or stationary phase

  • Subject to rapid dilution into hypotonic media

  • Measure survival rates by colony counting

  • Compare wild-type, mscL knockout, and complemented strains

• Protein expression analysis during osmotic stress:

  • Use proteomics approaches similar to those employed in other D. hafniense studies, such as Tandem Mass Tag labelling proteomics

  • Monitor MscL expression levels under different osmotic conditions

  • Identify co-regulated proteins in the stress response pathway

• Fluorescence microscopy:

  • Create fluorescent protein fusions with MscL to visualize localization

  • Observe changes in distribution during osmotic shock

  • Combine with membrane dyes to assess membrane integrity

These approaches can reveal the physiological importance of MscL in D. hafniense's adaptation to environmental stresses, particularly in its natural habitats like contaminated soils and sediments .

What bioinformatic tools are most useful for analyzing the evolutionary relationships of D. hafniense MscL with other mechanosensitive channels?

For evolutionary analysis of D. hafniense MscL, researchers should utilize:

• Multiple sequence alignment tools:

  • MUSCLE or T-Coffee for accurate alignment of MscL sequences across species

  • PRALINE or MEMSAT for membrane protein-specific alignments that account for transmembrane topology

  • Analysis should focus on conservation patterns in:

    • Transmembrane regions

    • Channel pore-lining residues

    • Cytoplasmic domains involved in gating

• Phylogenetic analysis software:

  • MrBayes or PhyML for Bayesian or maximum likelihood tree construction

  • ProtTest to select the optimal amino acid substitution model

  • FigTree for visualization and annotation of phylogenetic trees

  • Emphasis should be placed on evolutionary relationships between MscL channels from organisms sharing similar ecological niches

• Structural prediction and comparison:

  • AlphaFold2 for prediction of D. hafniense MscL structure

  • PyMOL or UCSF Chimera for structural comparison with experimentally determined MscL structures

  • ConSurf for mapping conservation onto structural models

• Genomic context analysis:

  • Study the genetic neighborhood of mscL in D. hafniense compared to other bacteria

  • Identify potential co-evolved genes involved in osmotic stress response

  • Examine promoter regions for regulatory elements related to stress response

This comparative approach can reveal unique adaptations of MscL in D. hafniense related to its anaerobic lifestyle and environmental niche .

How does the lipid composition affect the function of recombinant D. hafniense MscL, and what methodologies can detect these interactions?

The lipid environment critically influences MscL function through several mechanisms:

• Lipid-protein interaction studies:

  • Reconstitute purified D. hafniense MscL in liposomes with defined lipid compositions

  • Use microscale thermophoresis or surface plasmon resonance to measure binding affinities between specific lipids and the channel

  • Employ crosslinking approaches with photoactivatable lipid analogs to identify specific interaction sites

• Effect of membrane physical properties:

  • Systematically vary membrane thickness, curvature, and lateral pressure using different lipid compositions

  • Measure channel gating parameters (threshold pressure, open probability) as a function of these properties

  • Consider the natural membrane composition of D. hafniense, which as an anaerobe likely has distinct lipid characteristics compared to model organisms

• Fluorescence-based techniques:

  • Incorporate environment-sensitive fluorophores at specific sites in MscL through non-canonical amino acid mutagenesis

  • Monitor conformational changes in different lipid environments

  • Use FRET pairs to measure specific distance changes during gating

• Molecular dynamics simulations:

  • Construct atomistic models of D. hafniense MscL in different lipid bilayers

  • Simulate membrane deformation and channel gating

  • Calculate energetics of lipid-protein interactions

Research should particularly focus on how D. hafniense's adaptation to anaerobic environments might be reflected in the lipid sensitivity of its MscL channel, compared to aerobic bacteria .

What are the challenges and solutions for incorporating recombinant D. hafniense MscL into biomimetic systems for biosensing applications?

Incorporating functional D. hafniense MscL into biomimetic systems presents several challenges:

• Stability and orientation control:

  • Challenge: Maintaining the native pentameric structure and correct orientation in artificial membranes

  • Solution: Use directed immobilization strategies through site-specific tags or chemical modifications

  • Implementation: Introduce unique reactive groups via non-canonical amino acid incorporation at specific positions

• Signal transduction mechanism:

  • Challenge: Converting channel opening to detectable signals

  • Solution: Couple channel activity to:

    • Fluorescent reporter systems (calcium-sensitive dyes in vesicles)

    • Electrochemical detection on electrode surfaces

    • Enzyme-coupled reactions triggered by substrate transport through the channel

• Sensitivity and specificity tuning:

  • Challenge: Calibrating the response threshold for specific applications

  • Solution: Engineer variants with altered gating tension through targeted mutations

  • Methodology: Use deep mutational scanning to identify positions that alter gating sensitivity

• Biomimetic platform selection:

  • Supported lipid bilayers for electrical measurements

  • Polymer-encapsulated vesicles for increased stability

  • Hybrid systems incorporating the channel into solid-state nanopores

• Long-term stability considerations:

  • Incorporate antioxidants and membrane stabilizers

  • Optimize storage conditions (temperature, buffer composition)

  • Develop lyophilization protocols for shelf-stable systems

These challenges must be addressed systematically through iterative design and testing to fully exploit the mechanosensitive properties of D. hafniense MscL in biosensing applications.

How can recombinant DNA technology be used to engineer D. hafniense MscL variants with novel gating properties, and what safety considerations apply?

Engineering D. hafniense MscL variants with novel gating properties requires sophisticated recombinant DNA approaches:

• Mutagenesis strategies:

  • Site-directed mutagenesis targeting known gating residues identified through homology modeling

  • Domain swapping with MscL proteins from other species with distinct gating properties

  • Introduction of non-canonical amino acids with unique physicochemical properties at strategic positions

  • Creation of chimeric channels combining segments from mechanosensitive channels with different modalities

• Novel gating mechanisms:

  • Engineer light-sensitive gating by incorporating photoswitchable amino acids

  • Develop pH-dependent gating through histidine substitutions at key positions

  • Create redox-sensitive variants by strategic placement of cysteine residues

• High-throughput screening approaches:

  • Develop bacterial survival assays that select for specific gating properties

  • Fluorescence-based assays in multiwell format for rapid phenotyping

  • Microfluidic platforms for single-cell analysis of channel function

• Safety considerations and regulatory compliance:

  • All recombinant DNA work must comply with NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules

  • Institutional Biosafety Committee (IBC) approval is required before initiating work

  • Proper containment levels must be determined based on the risk assessment

  • Emergency response plans for spills and exposures must be established

  • Personnel must receive appropriate training in recombinant DNA techniques

What are common expression and purification challenges for recombinant D. hafniense MscL, and how can they be overcome?

Researchers frequently encounter several challenges when expressing and purifying recombinant D. hafniense MscL:

• Low expression levels:

  • Challenge: Membrane proteins often express poorly in heterologous systems

  • Solution: Optimize codon usage for the expression host

  • Implementation: Use strains with rare tRNA supplementation

  • Alternative approach: Test different promoter strengths and induction conditions

• Protein misfolding and aggregation:

  • Challenge: Improper membrane insertion leading to inclusion body formation

  • Solution: Express at lower temperatures (16-25°C) to slow folding

  • Implementation: Co-express molecular chaperones specific for membrane proteins

  • Verification method: Monitor protein localization in membrane vs. inclusion body fractions

• Maintaining the pentameric structure:

  • Challenge: Dissociation of native oligomeric state during extraction and purification

  • Solution: Carefully optimize detergent type and concentration

  • Recommendations:

    • DDM (n-Dodecyl β-D-maltoside) at 1% for extraction, 0.05% for purification

    • Consider newer amphipathic polymers or nanodiscs for increased stability

  • Validation: Size exclusion chromatography to confirm pentameric assembly

• Low protein yield and purity:

  • Challenge: Multi-step purification decreases final yield

  • Solution: Design efficient purification strategies based on protein properties

  • Implementation: For fusion proteins with human Fc tags, protein A affinity chromatography provides high selectivity

  • Alternative: Ion exchange chromatography using optimized buffer conditions (50 mM MES, pH 6.0)

• Troubleshooting guide:

How can researchers validate the structural integrity and functionality of purified recombinant D. hafniense MscL?

Comprehensive validation of recombinant D. hafniense MscL requires multiple complementary approaches:

• Structural integrity assessment:

  • Size exclusion chromatography to confirm pentameric assembly

  • Blue native PAGE to analyze oligomeric state under non-denaturing conditions

  • Negative-stain electron microscopy for direct visualization of protein complexes

  • Circular dichroism spectroscopy to verify secondary structure content

  • N-terminal sequencing by Edman degradation to confirm protein identity

• Functional validation strategies:

  • Planar lipid bilayer electrophysiology to measure channel conductance and gating properties

  • Liposome swelling assays to assess tension-dependent activation

  • Fluorescent dye release assays from MscL-reconstituted liposomes

  • In vivo complementation of MscL-deficient bacterial strains susceptible to osmotic shock

• Biophysical characterization:

  • Thermostability analysis using differential scanning fluorimetry

  • Isothermal titration calorimetry to measure interactions with ligands or lipids

  • Surface plasmon resonance for binding studies with potential modulators

  • Microscale thermophoresis to assess protein-lipid interactions

• Quality control metrics:

  • Purity assessment: >95% by SDS-PAGE and size exclusion chromatography

  • Homogeneity verification through dynamic light scattering

  • Mass spectrometry to confirm intact mass and post-translational modifications

  • Functional activity retention: >80% of channels should respond to tension in reconstituted systems

These validation approaches ensure that the recombinant protein accurately represents the native structure and function of D. hafniense MscL for reliable experimental outcomes.

What are the potential pitfalls when studying protein-protein interactions involving recombinant D. hafniense MscL?

Investigating protein-protein interactions with D. hafniense MscL presents several methodological challenges:

• Detergent interference:

  • Challenge: Detergents required for MscL solubilization may disrupt natural protein-protein interactions

  • Solution: Screen detergent-free systems like nanodiscs, amphipols, or SMALPs (styrene-maleic acid lipid particles)

  • Validation: Compare interaction profiles in multiple membrane mimetic systems

• Non-specific binding artifacts:

  • Challenge: Hydrophobic surfaces of membrane proteins often show high background in pull-down assays

  • Solution: Include stringent controls:

    • Tagged non-related membrane proteins as negative controls

    • Competition assays with excess untagged protein

    • Graduated salt concentration series to distinguish specific from non-specific interactions

• Contextual dependence of interactions:

  • Challenge: MscL interactions may depend on membrane environment or mechanical state

  • Solution: Study interactions in both resting and tension-activated states

  • Implementation: Crosslinking approaches to capture transient interactions during channel gating

• Complex formation verification:

  • Challenge: Distinguishing direct interactions from co-localization in the same membrane domain

  • Solution: Use proximity labeling techniques such as BioID or APEX2

  • Alternative: FRET-based approaches with site-specific fluorophore incorporation via non-canonical amino acids

• Interpreting interaction networks:

  • Challenge: D. hafniense has a complex physiology with potential unique interaction partners

  • Solution: Compare with interactomes from related bacteria with well-characterized MscL systems

  • Implementation: Use proteomic approaches similar to those that identified 2,796 proteins in D. hafniense DCB-2 under various growth conditions

When studying interactions, researchers should pay particular attention to potential partners involved in the organism's unique anaerobic metabolism and stress response pathways, as D. hafniense inhabits specialized ecological niches that may have driven the evolution of novel protein-protein interactions .