Recombinant Desulfitobacterium hafniense NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Desulfitobacterium hafniense NADH-quinone Oxidoreductase Subunit A (nuoA)

Recombinant Desulfitobacterium hafniense NADH-quinone oxidoreductase subunit A, encoded by the gene nuoA, is a crucial component of the NADH dehydrogenase complex, also known as Complex I or NDH-1. This enzyme complex plays a pivotal role in the respiratory chain of bacteria, facilitating the transfer of electrons from NADH to quinones, which is essential for generating a proton gradient across the cell membrane. This gradient is vital for ATP synthesis and maintaining cellular energy homeostasis.

Function and Structure

  • Function: The nuoA subunit is involved in the initial steps of electron transfer within the NDH-1 complex. It helps shuttle electrons from NADH to quinones via flavin mononucleotide (FMN) and iron-sulfur (Fe-S) centers. This process is coupled with proton translocation across the membrane, contributing to the proton gradient necessary for ATP production .

  • Structure: The NDH-1 complex in bacteria typically consists of 14 subunits, including nuoA. These subunits are embedded in the cell membrane and are essential for the enzyme's function as an electrogenic proton pump .

Research Findings

While specific research on the recombinant Desulfitobacterium hafniense NADH-quinone oxidoreductase subunit A (nuoA) might be limited, studies on similar bacterial systems provide valuable insights:

  • Electron Transfer Mechanism: The electron transfer process involves several subunits, including those with Fe-S clusters. The PSST subunit in mitochondrial Complex I and its bacterial counterpart, NQO6, are crucial for the final electron transfer step to quinone .

  • Inhibitor Studies: Various inhibitors, such as rotenone and piericidin A, target specific subunits in NADH-quinone oxidoreductases, highlighting the conserved nature of these enzymes across different species .

Comparison with Other NADH Dehydrogenases

  • NDH-2: Unlike NDH-1, NDH-2 does not pump protons and is primarily involved in maintaining the NAD+/NADH balance. It is present in some bacteria, including Staphylococcus aureus, which lacks Complex I .

  • NQR: This Na+-pumping NADH-quinone oxidoreductase is found in certain bacteria and contributes to energy conservation by generating a sodium gradient instead of a proton gradient .

Data Table: Comparison of NADH Dehydrogenases

EnzymeSubunitsIon PumpingEnergy ConservationFunction
NDH-114ProtonHighPrimary respiratory chain component
NDH-21NoneLowMaintains NAD+/NADH balance
NQR6SodiumHighContributes to energy conservation

References ECMDB. NADH-quinone oxidoreductase subunit A (P0AFC3) - ECMDB. PNAS. NADH-quinone oxidoreductase: PSST subunit couples electron... PMC. The two alternative NADH:quinone oxidoreductases from Staphylococcus aureus... MetaCyc. NADH:quinone oxidoreductase I, peripheral arm. Nature. Cryo-EM structures of Na+-pumping NADH-ubiquinone... PMC. The three NADH dehydrogenases of Pseudomonas aeruginosa... BioCyc. Escherichia coli K-12 substr. MG1655 NADH:quinone...

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
nuoA; DSY2588; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Desulfitobacterium hafniense (strain Y51)
Target Names
nuoA
Target Protein Sequence
MSDNFAAVGIALVVAIAINLIMMLMPKLLAPKKPVPEKLTPYEGGNQTIGRTWLGFKSNY FLYALVFTAFDVETVFLFPWALSFRQLGTFAFIEMFVFIVILLVGFWYAWKEGALEWM
Uniprot No.

Target Background

Function

NDH-1 (NADH-quinone oxidoreductase subunit A) facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving energy in a proton gradient.

Database Links

KEGG: dsy:DSY2588

STRING: 138119.DSY2588

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of the nuoA gene in Desulfitobacterium hafniense strain DCB-2?

The nuoA gene in D. hafniense strain DCB-2 is part of the nuoABCDHIJKLMN operon (locus ACL21757-67). This operon encodes an 11-subunit complex I-like enzyme that notably lacks the nuoE, F, and G subunits which typically form the NADH-oxidizing module in complete complex I systems. The nuoA subunit represents the first gene in this operon, and its expression is coordinated with other subunits to form the functional complex I-like enzyme . The genetic organization distinguishes this system from canonical complex I arrangements found in aerobic organisms, reflecting the adaptation of D. hafniense to anaerobic environments and alternative electron transport chains.

How does the nuoA subunit contribute to the electron transport chain in D. hafniense?

The nuoA subunit forms an essential component of the complex I-like enzyme in D. hafniense, which serves as an entry point for electrons into the respiratory chain. Unlike conventional complex I, which oxidizes NADH directly, the D. hafniense complex likely accepts electrons from alternative donors through redox mediators such as ferredoxins. Research using the specific complex I inhibitor rotenone has demonstrated that this enzyme is essential for growth when the bacterium utilizes organic electron donors like lactate and pyruvate, but not when hydrogen serves as the electron donor . This suggests that nuoA, as part of the complex I-like enzyme, plays a crucial role in cytoplasmic electron transfer rather than in the direct oxidation of NADH, reflecting the adaptation of D. hafniense to anaerobic energy metabolism.

Why is the nuoA subunit significant for bioremediation applications?

The nuoA subunit's importance lies in its role within the energy conservation system of D. hafniense, an organism with significant bioremediation potential. D. hafniense belongs to the Firmicutes phylum (recently renamed Bacillota) and is capable of using various molecules as electron donors and acceptors, including several organohalogens . This metabolic versatility makes D. hafniense valuable for bioremediation of halogenated compounds. The nuoA subunit, as part of the complex I-like enzyme, contributes to the electron transport machinery that ultimately powers organohalide respiration. Understanding nuoA function can potentially lead to optimized bioremediation strategies by elucidating the fundamental energy conservation mechanisms that support D. hafniense growth during dehalogenation processes.

What cultivation methods are most effective for studying nuoA function in D. hafniense?

Researchers should implement strict anaerobic cultivation techniques using specialized media for optimal study of nuoA function. Based on established protocols, the most effective approach involves using a basal medium that can be modified with different electron donors and acceptors to trigger specific metabolic pathways. Six growth conditions that have proven valuable for nuoA functional studies include:

Growth ConditionElectron DonorElectron AcceptorAdditional Components
Py-onlyPyruvate (40 mM)None (fermentative)-
Py/FuPyruvate (20 mM)Fumarate (20 mM)-
La/FuLactate (20 mM)Fumarate (20 mM)-
La/ClOHPALactate (20 mM)ClOHPA (10 mM)-
H₂/FuHydrogenFumarate (20 mM)Acetic acid (2 mM)
H₂/ClOHPAHydrogenClOHPA (10 mM)Acetic acid (2 mM)
Cultivation should be performed in 40 mL or 200 mL anaerobic flasks with appropriate gas phase composition. Growth monitoring via optical density measurement at 600 nm (OD₆₀₀) allows for tracking the effects of experimental manipulations on growth kinetics .

How can inhibitors be used to study the functional role of nuoA in D. hafniense?

Inhibitor studies represent a powerful approach to elucidate nuoA function within the complex I-like enzyme. Rotenone, a specific complex I inhibitor, can be employed in two experimental designs:

  • Growth inhibition experiments: Add rotenone (dissolved in ethanol) to the culture medium before inoculation. Include appropriate controls (positive control without additions and ethanol-only control) to distinguish between inhibitor effects and solvent effects. Monitor growth by OD₆₀₀ measurements over time.

  • Spike experiments: Allow cultures to grow to mid-exponential phase, then add rotenone. This approach helps distinguish between immediate inhibitory effects and adaptive responses. The data from spike experiments showed that when rotenone was added to growing cultures with organic electron donors (pyruvate or lactate), growth was immediately affected, while cultures using hydrogen as an electron donor showed no significant growth inhibition .
    For more nuanced analysis, researchers can conduct rescue experiments by supplementing hydrogen to rotenone-inhibited cultures, as demonstrated in supplementary experiments where hydrogen addition partially rescued growth of rotenone-inhibited cultures, indicating metabolic flexibility .

What proteomic approaches are most effective for studying nuoA interactions?

Comparative proteomic analysis represents the most effective approach for identifying potential interaction partners of nuoA. The methodology should include:

  • Sample preparation: Cultivate D. hafniense under multiple growth conditions that differentially affect nuoA expression.

  • Protein extraction and quantification: Use standardized protocols ensuring consistent extraction efficiency across samples.

  • Mass spectrometry analysis: Implement liquid chromatography-tandem mass spectrometry (LC-MS/MS) for protein identification and quantification.

  • Relative abundance calculation: Convert protein abundance data to Z-scores to normalize expression patterns across conditions.

  • Pattern matching analysis: Calculate the median Z-score pattern for all Nuo subunits (including nuoA) and use Euclidean distance metrics to identify proteins with similar expression patterns.
    This approach successfully identified 47 proteins with expression patterns similar to Nuo subunits in D. hafniense strain DCB-2, of which seven were redox proteins that could potentially interact with the complex I-like enzyme . The methodology can be refined by focusing specifically on nuoA pull-down assays or crosslinking studies to confirm direct interaction partners.

How does nuoA expression vary under different growth conditions, and what does this reveal about its function?

Analysis of nuoA expression across different growth conditions provides critical insights into its functional significance. Proteomic data from D. hafniense strain DCB-2 revealed that nuoA shows a characteristic expression pattern, although with more variation than other Nuo subunits. The relative abundance of nuoA across six growth conditions is summarized below:

What are the potential redox partners of nuoA based on proteomic evidence?

Proteomic analysis has identified several potential redox partners for the complex I-like enzyme containing nuoA. Based on expression pattern similarity (Euclidean distance to the median Nuo expression pattern), seven redox proteins have emerged as strong candidates for interaction:

Protein IDAnnotationCofactorsEuclidean DistancePotential Interaction Mechanism
ACL18023Pyruvate ferredoxin oxidoreductase (PFOR)Fe-S clustersLowPrimary electron donor during pyruvate oxidation
ACL21378FerredoxinFe-S clustersLowElectron shuttle from PFOR to complex I-like enzyme
ACL19056FeFe-hydrogenaseFe-S clustersLowPotential direct electron transfer upon H₂ oxidation
ACL20267-8Oxidoreductase complexUnknownLowAlternative electron donor system
ACL21807-8Oxidoreductase complexUnknownLowAlternative electron donor system
ACL18123Redox proteinUnknownLowPotential electron shuttle
The pyruvate ferredoxin oxidoreductase (PFOR) represents the most promising candidate as an electron-donating enzyme, particularly in conditions where pyruvate oxidation to acetyl-CoA occurs. Ferredoxins likely shuttle electrons from PFOR to the complex I-like enzyme . These potential redox partners provide a framework for designing targeted interaction studies to further elucidate the electron transfer network involving nuoA.

How can researchers differentiate between the roles of different Nuo subunits when studying recombinant nuoA?

Differentiating between the roles of individual Nuo subunits requires a multi-faceted approach:

  • Subunit-specific knockout or knockdown studies: Generate conditional knockouts or knockdowns of individual Nuo subunits, including nuoA, to observe differential phenotypes.

  • Complementation experiments: Express recombinant subunits in knockout strains to confirm functionality and identify subunit-specific effects.

  • Structural biology approaches: Use cryo-electron microscopy or X-ray crystallography of the recombinant complex with and without specific subunits to determine structural roles.

  • Biochemical activity assays: Develop in vitro reconstitution systems with purified recombinant subunits to measure electron transfer activities with various electron donors and acceptors.

  • Site-directed mutagenesis: Create point mutations in conserved residues of nuoA to identify critical functional sites without disrupting the entire complex.
    When studying recombinant nuoA specifically, researchers should recognize that nuoA and nuoJ showed more variable expression patterns than other Nuo subunits in the D. hafniense studies . This suggests these subunits might be subject to additional regulatory mechanisms or have functional roles distinct from the core complex activity.

What are common challenges in expressing and purifying active recombinant nuoA, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant nuoA:

  • Protein solubility issues: nuoA is a membrane-associated protein that often forms inclusion bodies when overexpressed.

    • Solution: Use membrane-mimetic expression systems or fusion tags that enhance solubility (e.g., MBP or SUMO tags).

    • Alternative: Express nuoA alongside other complex I-like subunits to promote proper folding and assembly.

  • Loss of activity during purification: nuoA may lose functionality when removed from its native complex.

    • Solution: Implement gentle detergent-based extraction methods (e.g., digitonin or lauryl maltose neopentyl glycol) that preserve protein-protein interactions.

    • Alternative: Consider co-expression and co-purification of interacting subunits.

  • Oxidative damage during handling: Iron-sulfur clusters and other redox centers are susceptible to oxidation.

    • Solution: Perform all purification steps under anaerobic conditions with reducing agents present.

  • Heterologous expression host limitations: Standard E. coli systems may lack necessary cofactors or post-translational modifications.

    • Solution: Consider expression in closer related organisms or cell-free systems supplemented with appropriate cofactors.
      The interpretation of functional studies with recombinant nuoA should account for these technical challenges, particularly when comparing activity to the native complex.

How should researchers interpret differential inhibition patterns when studying nuoA function?

The differential inhibition patterns observed with complex I inhibitors provide valuable insights into nuoA function, but require careful interpretation:

  • Growth condition-dependent effects: The research on D. hafniense showed that rotenone completely inhibited growth with organic electron donors (pyruvate/fumarate, lactate/fumarate) but had no effect when hydrogen served as the electron donor .

    • Interpretation: The complex I-like enzyme (including nuoA) is essential for electron transport from organic donors but not from hydrogen.

  • Inhibitor specificity considerations: When multiple inhibitors show different effects (e.g., rotenone vs. piericidin A), researchers should consider:

    • Binding site variations: Mutations in nuoA or interacting subunits may affect inhibitor binding differently.

    • Dosage effects: "The observed effect might be explained by a reduced affinity of the complex I-like enzyme for piericidin" compared to rotenone .

  • Recovery experiments: The partial recovery of growth when hydrogen was added to rotenone-inhibited cultures indicates:

    • Metabolic flexibility: The bacterium can switch electron donors when one pathway is blocked.

    • Inhibitor specificity: Rotenone specifically blocks the organic electron donor pathway without affecting hydrogen utilization.
      When designing inhibitor studies for nuoA function, researchers should include multiple inhibitors at various concentrations and consider combining inhibitor studies with genetic approaches for comprehensive analysis.

How can conflicting data on nuoA function be reconciled across different experimental approaches?

Conflicting data on nuoA function can arise from various sources and require systematic reconciliation:

  • Growth condition variations: The D. hafniense study demonstrated different roles for the complex I-like enzyme depending on electron donors and acceptors . Researchers should:

    • Standardize growth conditions across experiments

    • Report detailed media compositions

    • Consider subtle differences in trace elements or vitamins that may affect metabolism

  • Strain-specific differences: Even within the same species, strains may show different nuoA functions:

    • D. hafniense strain DCB-2 and strain TCE1 showed similar responses to rotenone in most conditions

    • Strain-specific adaptations should be considered when comparing results across studies

  • Technical approach discrepancies: Different methods may yield apparently contradictory results:

    • Genetic studies (knockouts) may show different phenotypes than inhibitor studies

    • Proteomic data may suggest interactions that biochemical studies fail to confirm

  • Integrated data analysis approach: To reconcile conflicting data, researchers should:

    • Employ multiple, complementary techniques to study nuoA function

    • Consider that nuoA may have condition-specific roles

    • Use systems biology approaches to integrate diverse datasets
      The experimental evidence suggesting that "the complex I-like enzyme of D. hafniense strain DCB-2 serves as an electron entry point into the respiratory chain for substrates delivering electrons within the cytoplasm" provides a framework for interpreting seemingly conflicting results.

What approaches should be prioritized for studying direct protein interactions with recombinant nuoA?

To advance understanding of nuoA interactions, researchers should prioritize:

  • In vivo crosslinking coupled with mass spectrometry: This approach can capture transient interactions under physiologically relevant conditions.

    • Apply membrane-permeable crosslinkers to living D. hafniense cells

    • Purify complexes containing nuoA and identify crosslinked partners

  • Fluorescence resonance energy transfer (FRET): For monitoring dynamic interactions:

    • Generate fluorescently tagged versions of nuoA and candidate partners

    • Express in native host or reconstituted membrane systems

    • Monitor interaction events in real-time under varying conditions

  • Bacterial two-hybrid systems adapted for membrane proteins: To systematically screen for interactions:

    • Create a library of D. hafniense proteins fused to appropriate reporters

    • Screen for interactions with nuoA under anaerobic conditions

    • Validate identified interactions through secondary methods

  • Cryo-electron microscopy of the intact complex: To determine structural relationships:

    • Purify the native complex I-like enzyme from D. hafniense

    • Use subtomogram averaging to resolve subunit arrangements

    • Compare with structures containing recombinant nuoA

  • Hydrogen-deuterium exchange mass spectrometry: To map interaction interfaces:

    • Compare exchange patterns of nuoA alone versus in complex

    • Identify protected regions indicating binding interfaces
      These approaches would build upon the proteomic correlation data that identified potential redox partners with expression patterns similar to nuoA and other Nuo subunits .

How might genetic modification of nuoA enhance bioremediation capabilities of D. hafniense?

Strategic genetic modification of nuoA could potentially enhance bioremediation applications in several ways:

  • Increasing electron transfer efficiency:

    • Identify rate-limiting steps in the electron transport chain involving nuoA

    • Engineer nuoA variants with improved electron acceptance/donation capabilities

    • Test modified strains for enhanced dehalogenation rates

  • Expanding substrate range:

    • Modify nuoA to alter the redox potential of the complex I-like enzyme

    • Screen for enhanced ability to use alternative electron donors

    • Evaluate performance with recalcitrant halogenated compounds

  • Improving stress tolerance:

    • Engineer nuoA variants with enhanced stability under environmental stressors

    • Test performance under conditions relevant to contaminated sites

    • Develop strains with improved survival in bioremediation applications

  • Creating regulatory circuit modifications:

    • Alter nuoA expression control to respond to contaminant presence

    • Develop biosensor-regulator systems that upregulate nuoA when target pollutants are detected

    • Design strains that optimize energy conservation for dehalogenation
      These approaches should be guided by the understanding that the complex I-like enzyme is essential for growth with organic electron donors but not with hydrogen , suggesting strategic pathways for optimization depending on available electron donors at contaminated sites.

What computational approaches could reveal evolutionary insights about nuoA in anaerobic bacteria?

Several computational approaches can illuminate the evolutionary history of nuoA:

  • Comparative genomics across diverse bacteria:

    • Analyze nuoA sequence conservation patterns across aerobic and anaerobic lineages

    • Map presence/absence of nuoA and other complex I subunits across the bacterial tree of life

    • Identify co-evolution patterns between nuoA and other respiratory components

  • Structural bioinformatics:

    • Generate homology models of nuoA from diverse species

    • Compare predicted structures to identify conserved functional domains

    • Assess structural adaptations in anaerobes versus aerobes

  • Reconstructing ancestral sequences:

    • Apply maximum likelihood methods to infer ancestral nuoA sequences

    • Synthesize and characterize ancestral proteins to test functional hypotheses

    • Trace the evolutionary trajectory of nuoA function

  • Codon usage and selection analysis:

    • Examine selection pressures acting on nuoA in different bacterial lineages

    • Identify signatures of adaptation versus conservation

    • Correlate selection patterns with ecological niches

  • Horizontal gene transfer detection:

    • Analyze genomic context and nucleotide composition of nuoA

    • Identify potential horizontal gene transfer events

    • Assess the role of gene transfer in disseminating complex I-like systems
      These approaches would build on the observation that D. hafniense possesses "an ancestral version of the complex [I], lacking the NADH-oxidising module" , providing insights into the evolution of respiratory systems in anaerobic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.