Recombinant Desulfitobacterium hafniense NADH-quinone oxidoreductase subunit K (nuoK) is a full-length, His-tagged protein derived from the nuoK gene (UniProt ID: B8FRK0). It is a component of the bacterial NADH-quinone oxidoreductase (Complex I), a key enzyme in anaerobic respiration, particularly in organohalide-respiring bacteria like D. hafniense . The protein is engineered for laboratory use, expressed in E. coli (or mammalian cells in some formulations), and purified to >85–90% purity .
The nuoK protein sequence (1–110 residues) is:
MSISVGLGSYLLVGAMLFCLGLYGVFVKRNIIAILMSIELMLNAVNINFIAFSRFAPWANPGTNPLIGQVAAIFVIVVAAAEIAVGLALVIAIYRNRRTTNVDEFNWLKW
This sequence aligns with the cytoplasmic or membrane-associated domains of bacterial Complex I, which facilitates electron transfer from NADH to quinones while generating a proton gradient .
In D. hafniense, the Complex I-like enzyme is an 11-subunit variant (nuoABCDHIJKLMN) lacking the NADH-oxidizing module (nuoEFG) . Subunit K (nuoK) is thought to contribute to:
Quinone Reduction: Transfer of electrons to menaquinone, a critical step in anaerobic respiration.
Proton Pumping: Maintenance of proton motive force for ATP synthesis.
Structural Stability: Anchoring the peripheral arm (quinone-reducing module) to the membrane-integrated proton-pumping module .
Studies using rotenone (a Complex I inhibitor) revealed nuoK’s essentiality in specific metabolic pathways:
Lactate/Pyruvate Respiration: Growth ceases under rotenone inhibition, indicating dependency on Complex I-like for electron transfer .
Hydrogen Respiration: Growth persists, suggesting alternative electron donors (e.g., ferredoxins) bypass the Complex I-like enzyme .
Proteomic analyses of D. hafniense strain DCB-2 show consistent expression of nuoK across growth conditions, with elevated abundance in pyruvate/fumarate or lactate/fumarate-driven respiration . This highlights its adaptability in diverse energy-yielding pathways.
Potential redox partners include:
Ferredoxins: Likely shuttle electrons to the Complex I-like enzyme in lactate/pyruvate metabolism .
FMN-Binding Proteins: Homologs of RdhC (e.g., PceC in Dehalobacter restrictus) may mediate electron transfer to quinones .
Two formulations are documented:
| Formulation | Host | Tag | Purity | Application |
|---|---|---|---|---|
| Cusabio (CSB-MP489307DJJ1) | Mammalian cells | Undisclosed | >85% | Research (e.g., enzymatic studies) |
| Creative BioMart (RFL3157DF) | E. coli | N-terminal His | >90% | Structural/biochemical studies |
Both products are lyophilized and require reconstitution in deionized water with glycerol for stability .
KEGG: dhd:Dhaf_3744
NuoK functions as an integral membrane subunit of the complex I-like enzyme (NADH:quinone oxidoreductase). Within this multiprotein complex, nuoK contributes to the proton translocation pathway that couples electron transfer to proton pumping across the membrane. The complex I-like enzyme shows differential expression based on growth conditions, being more abundant when D. hafniense grows on pyruvate or lactate with fumarate as electron acceptor . Methodologically, researchers can study nuoK function through site-directed mutagenesis of conserved residues followed by membrane potential measurements in reconstituted systems.
Proteomic studies reveal that nuoK expression, along with other Nuo subunits, follows a specific pattern across different growth conditions. The relative abundance of Nuo proteins is higher in pyruvate-only (Py-only), pyruvate/fumarate (Py/Fu), and lactate/fumarate (La/Fu) conditions, while being less abundant in hydrogen-based metabolism, particularly with H₂/ClOHPA . This suggests metabolic regulation that corresponds to the bacteria's energy needs under different respiratory modes. To investigate this phenomenon, researchers should design experiments comparing transcriptomic and proteomic profiles across carefully controlled growth conditions with varying electron donors and acceptors.
Within the D. hafniense genome, nuoK is part of the nuo gene cluster encoding the NADH:quinone oxidoreductase complex components. D. hafniense strain DCB-2 possesses a highly versatile metabolism with redundant members of redox enzyme families . While the specific organization of nuoK wasn't detailed in the search results, researchers should analyze genomic data to examine its position within the operon structure and identify potential regulatory elements governing its expression.
As a membrane-embedded component, nuoK likely contains transmembrane helices that form part of the proton translocation pathway. While specific structural data for D. hafniense nuoK wasn't provided in the search results, researchers can conduct comparative structural analyses with homologous proteins from model organisms. Experimental approaches should include cysteine-scanning mutagenesis coupled with accessibility studies to map transmembrane regions and potential proton-conducting channels.
D. hafniense displays remarkable metabolic flexibility, growing in various respiratory and fermentative modes . Researchers should investigate whether nuoK contains unique structural features compared to homologs in less metabolically versatile organisms. Computational approaches including sequence alignment, hydrophobicity analysis, and evolutionary trace methods can identify conserved and divergent regions potentially related to functional specialization.
NuoK functions as part of a larger protein complex where subunit interactions are crucial for both structural integrity and functional electron transfer. To study these interactions, researchers should employ crosslinking mass spectrometry approaches to capture interaction interfaces in native conditions. Co-purification experiments with tagged subunits can also reveal stable interaction partners within the complex.
Expressing membrane proteins like nuoK presents significant challenges. Researchers should consider:
Using specialized E. coli strains (C41/C43) designed for membrane protein expression
Employing low-copy number vectors with tunable promoters
Conducting expression at reduced temperatures (16-25°C)
Testing multiple fusion tags (His, Strep, MBP) for optimal expression and solubility
Evaluating cell-free expression systems for difficult constructs
Expressing with other interacting subunits may improve stability and proper folding.
A methodical purification approach should include:
| Step | Method | Purpose | Critical Parameters |
|---|---|---|---|
| 1 | Membrane isolation | Separate membrane fraction | Gentle lysis, differential centrifugation |
| 2 | Solubilization | Extract protein from membrane | Test multiple detergents (DDM, LMNG, GDN) |
| 3 | Affinity chromatography | Initial purification | Maintain detergent above CMC |
| 4 | Size exclusion | Remove aggregates | Buffer optimization for stability |
| 5 | Functional validation | Confirm proper folding | Activity assays or binding studies |
Researchers should monitor protein quality throughout using techniques like SEC-MALS to assess monodispersity.
Verification of proper complex assembly requires multiple complementary approaches:
Blue native PAGE to visualize intact complexes
Activity assays measuring NADH:quinone oxidoreductase function
Antibody-based detection of co-purifying subunits
Mass spectrometry to identify interacting partners
Electron microscopy to visualize complex architecture
Researchers should compare results from recombinant systems with native complexes isolated from D. hafniense.
Experiments with D. hafniense demonstrate that rotenone, a specific complex I inhibitor, strongly inhibits growth when cells utilize lactate but less so with hydrogen as electron donor . While rotenone likely binds at the interface between NADH dehydrogenase and quinone-binding modules rather than directly to nuoK, understanding this sensitivity provides insights into electron transport pathways. Researchers should design experiments comparing growth inhibition patterns with site-directed mutants of key complex I subunits to map the inhibitor binding site.
Proteomic analysis reveals differential expression patterns of the complex I-like enzyme across various growth conditions. The relative abundance (Z-scores) of Nuo subunits across different growth conditions shows a distinct pattern :
| Growth Condition | Relative Abundance (Z-score) | Metabolic Mode |
|---|---|---|
| Py/Fu | 0.7 to 0.9 | Respiratory with pyruvate |
| La/Fu | 0.4 to 0.7 | Respiratory with lactate |
| Py-only | 0.6 to 0.8 | Partially fermentative |
| La/ClOHPA | -0.5 to -0.2 | Organohalide respiration |
| H₂/Fu | -0.7 to -0.5 | H₂-based respiration |
| H₂/ClOHPA | -1.0 to -0.8 | H₂-driven OHR |
This pattern suggests complex I involvement varies with metabolic mode, being more critical when organic electron donors (pyruvate, lactate) are used compared to hydrogen.
Proteomic analysis identified potential functional partners of the complex I-like enzyme based on similar expression patterns . These include:
Pyruvate ferredoxin oxidoreductase (ACL18023) - likely provides electrons when pyruvate is the electron donor
Ferredoxin (ACL21378) - potentially shuttles electrons between PFOR and complex I
Additional redox proteins showing similar abundance profiles
Researchers should investigate these interactions through co-purification studies and reconstitution experiments measuring electron transfer rates between purified components.
D. hafniense displays remarkable metabolic versatility, adapting to various environmental electron donors and acceptors . The up-regulation patterns of nuoK and other complex I components under specific conditions suggest this complex plays variable roles depending on available substrates. Researchers should design competition experiments between wild-type and nuoK-modified strains under different growth conditions to quantify fitness effects.
The expression profile of nuoK appears coordinated with other metabolic components, including pyruvate ferredoxin oxidoreductase and ferredoxin . To understand this coordination, researchers should perform integrated transcriptomic and proteomic analyses, particularly focusing on potential transcriptional regulators that might co-regulate these systems. Time-course studies during metabolic shifts could reveal the sequential activation of these components.
Proteomic analysis revealed that addition of sodium sulfide as a reducing agent triggered expression of the dissimilatory sulfite reduction pathway in D. hafniense, particularly under fermentative growth on pyruvate, H₂ respiration, and organohalide respiration conditions . Researchers should investigate whether electron flow through the complex I-like enzyme connects to this pathway, possibly by comparing redox balances in wild-type versus nuoK-modified strains.
Unlike obligate organohalide-respiring bacteria such as Dehalococcoides mccartyi, D. hafniense shows metabolic flexibility with varied electron donors and acceptors . Comparative analysis of nuoK from these organisms might reveal adaptations related to this metabolic versatility. Researchers should perform detailed sequence and structural comparisons, followed by functional complementation studies in appropriate host systems.
Additional experiments with D. hafniense strain TCE1 showed similar rotenone sensitivity patterns to strain DCB-2, with growth inhibition when using lactate but less affected when using hydrogen . This suggests conserved complex I function across strains. Researchers should extend these comparisons to additional Desulfitobacterium species and strains to establish whether nuoK expression patterns correlate with specific metabolic capabilities.
D. hafniense possesses multiple redox enzyme families , suggesting potential redundancy in electron transport chains. Researchers should investigate whether alternative NADH-oxidizing enzymes exist and how they interact functionally with the complex I-like enzyme. Deletion studies targeting specific components followed by growth phenotyping under various conditions would reveal the degree of redundancy and specialization.