Recombinant Desulfitobacterium hafniense NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Recombinant Desulfitobacterium hafniense NADH-Quinone Oxidoreductase Subunit K (nuoK): Overview

Recombinant Desulfitobacterium hafniense NADH-quinone oxidoreductase subunit K (nuoK) is a full-length, His-tagged protein derived from the nuoK gene (UniProt ID: B8FRK0). It is a component of the bacterial NADH-quinone oxidoreductase (Complex I), a key enzyme in anaerobic respiration, particularly in organohalide-respiring bacteria like D. hafniense . The protein is engineered for laboratory use, expressed in E. coli (or mammalian cells in some formulations), and purified to >85–90% purity .

Amino Acid Sequence

The nuoK protein sequence (1–110 residues) is:
MSISVGLGSYLLVGAMLFCLGLYGVFVKRNIIAILMSIELMLNAVNINFIAFSRFAPWANPGTNPLIGQVAAIFVIVVAAAEIAVGLALVIAIYRNRRTTNVDEFNWLKW
This sequence aligns with the cytoplasmic or membrane-associated domains of bacterial Complex I, which facilitates electron transfer from NADH to quinones while generating a proton gradient .

Role in Complex I-Like Enzyme

In D. hafniense, the Complex I-like enzyme is an 11-subunit variant (nuoABCDHIJKLMN) lacking the NADH-oxidizing module (nuoEFG) . Subunit K (nuoK) is thought to contribute to:

  1. Quinone Reduction: Transfer of electrons to menaquinone, a critical step in anaerobic respiration.

  2. Proton Pumping: Maintenance of proton motive force for ATP synthesis.

  3. Structural Stability: Anchoring the peripheral arm (quinone-reducing module) to the membrane-integrated proton-pumping module .

Critical Role in Anaerobic Metabolism

Studies using rotenone (a Complex I inhibitor) revealed nuoK’s essentiality in specific metabolic pathways:

  • Lactate/Pyruvate Respiration: Growth ceases under rotenone inhibition, indicating dependency on Complex I-like for electron transfer .

  • Hydrogen Respiration: Growth persists, suggesting alternative electron donors (e.g., ferredoxins) bypass the Complex I-like enzyme .

Proteomic Evidence

Proteomic analyses of D. hafniense strain DCB-2 show consistent expression of nuoK across growth conditions, with elevated abundance in pyruvate/fumarate or lactate/fumarate-driven respiration . This highlights its adaptability in diverse energy-yielding pathways.

Electron Transfer Partners

Potential redox partners include:

  • Ferredoxins: Likely shuttle electrons to the Complex I-like enzyme in lactate/pyruvate metabolism .

  • FMN-Binding Proteins: Homologs of RdhC (e.g., PceC in Dehalobacter restrictus) may mediate electron transfer to quinones .

Recombinant Production Systems

Two formulations are documented:

FormulationHostTagPurityApplication
Cusabio (CSB-MP489307DJJ1)Mammalian cellsUndisclosed>85%Research (e.g., enzymatic studies)
Creative BioMart (RFL3157DF)E. coliN-terminal His>90%Structural/biochemical studies

Both products are lyophilized and require reconstitution in deionized water with glycerol for stability .

Handling Recommendations

  • Storage: -20°C/-80°C (avoid repeated freeze-thaw cycles).

  • Reconstitution: 0.1–1.0 mg/mL in sterile water with 5–50% glycerol .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
nuoK; Dhaf_3744; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Desulfitobacterium hafniense (strain DCB-2 / DSM 10664)
Target Names
nuoK
Target Protein Sequence
MSISVGLGSYLLVGAMLFCLGLYGVFVKRNIIAILMSIELMLNAVNINFIAFSRFAPWAN PGTNPLIGQVAAIFVIVVAAAEIAVGLALVIAIYRNRRTTNVDEFNWLKW
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's primary electron acceptor is believed to be a menaquinone. NDH-1 couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase subunit K (nuoK) in Desulfitobacterium hafniense?

NuoK functions as an integral membrane subunit of the complex I-like enzyme (NADH:quinone oxidoreductase). Within this multiprotein complex, nuoK contributes to the proton translocation pathway that couples electron transfer to proton pumping across the membrane. The complex I-like enzyme shows differential expression based on growth conditions, being more abundant when D. hafniense grows on pyruvate or lactate with fumarate as electron acceptor . Methodologically, researchers can study nuoK function through site-directed mutagenesis of conserved residues followed by membrane potential measurements in reconstituted systems.

How is nuoK expression regulated in response to different metabolic conditions?

Proteomic studies reveal that nuoK expression, along with other Nuo subunits, follows a specific pattern across different growth conditions. The relative abundance of Nuo proteins is higher in pyruvate-only (Py-only), pyruvate/fumarate (Py/Fu), and lactate/fumarate (La/Fu) conditions, while being less abundant in hydrogen-based metabolism, particularly with H₂/ClOHPA . This suggests metabolic regulation that corresponds to the bacteria's energy needs under different respiratory modes. To investigate this phenomenon, researchers should design experiments comparing transcriptomic and proteomic profiles across carefully controlled growth conditions with varying electron donors and acceptors.

What is the genomic context of nuoK in D. hafniense strain DCB-2?

Within the D. hafniense genome, nuoK is part of the nuo gene cluster encoding the NADH:quinone oxidoreductase complex components. D. hafniense strain DCB-2 possesses a highly versatile metabolism with redundant members of redox enzyme families . While the specific organization of nuoK wasn't detailed in the search results, researchers should analyze genomic data to examine its position within the operon structure and identify potential regulatory elements governing its expression.

How does the structure of D. hafniense nuoK contribute to proton translocation?

As a membrane-embedded component, nuoK likely contains transmembrane helices that form part of the proton translocation pathway. While specific structural data for D. hafniense nuoK wasn't provided in the search results, researchers can conduct comparative structural analyses with homologous proteins from model organisms. Experimental approaches should include cysteine-scanning mutagenesis coupled with accessibility studies to map transmembrane regions and potential proton-conducting channels.

What structural adaptations in nuoK might reflect D. hafniense's metabolic versatility?

D. hafniense displays remarkable metabolic flexibility, growing in various respiratory and fermentative modes . Researchers should investigate whether nuoK contains unique structural features compared to homologs in less metabolically versatile organisms. Computational approaches including sequence alignment, hydrophobicity analysis, and evolutionary trace methods can identify conserved and divergent regions potentially related to functional specialization.

How do nuoK interactions with other complex I subunits facilitate electron transport?

NuoK functions as part of a larger protein complex where subunit interactions are crucial for both structural integrity and functional electron transfer. To study these interactions, researchers should employ crosslinking mass spectrometry approaches to capture interaction interfaces in native conditions. Co-purification experiments with tagged subunits can also reveal stable interaction partners within the complex.

What expression systems are optimal for producing recombinant D. hafniense nuoK?

Expressing membrane proteins like nuoK presents significant challenges. Researchers should consider:

  • Using specialized E. coli strains (C41/C43) designed for membrane protein expression

  • Employing low-copy number vectors with tunable promoters

  • Conducting expression at reduced temperatures (16-25°C)

  • Testing multiple fusion tags (His, Strep, MBP) for optimal expression and solubility

  • Evaluating cell-free expression systems for difficult constructs

Expressing with other interacting subunits may improve stability and proper folding.

What purification strategy yields functional recombinant nuoK for biochemical studies?

A methodical purification approach should include:

StepMethodPurposeCritical Parameters
1Membrane isolationSeparate membrane fractionGentle lysis, differential centrifugation
2SolubilizationExtract protein from membraneTest multiple detergents (DDM, LMNG, GDN)
3Affinity chromatographyInitial purificationMaintain detergent above CMC
4Size exclusionRemove aggregatesBuffer optimization for stability
5Functional validationConfirm proper foldingActivity assays or binding studies

Researchers should monitor protein quality throughout using techniques like SEC-MALS to assess monodispersity.

How can researchers assess nuoK incorporation into functional complex I assemblies?

Verification of proper complex assembly requires multiple complementary approaches:

  • Blue native PAGE to visualize intact complexes

  • Activity assays measuring NADH:quinone oxidoreductase function

  • Antibody-based detection of co-purifying subunits

  • Mass spectrometry to identify interacting partners

  • Electron microscopy to visualize complex architecture

Researchers should compare results from recombinant systems with native complexes isolated from D. hafniense.

How does nuoK contribute to rotenone sensitivity in D. hafniense?

Experiments with D. hafniense demonstrate that rotenone, a specific complex I inhibitor, strongly inhibits growth when cells utilize lactate but less so with hydrogen as electron donor . While rotenone likely binds at the interface between NADH dehydrogenase and quinone-binding modules rather than directly to nuoK, understanding this sensitivity provides insights into electron transport pathways. Researchers should design experiments comparing growth inhibition patterns with site-directed mutants of key complex I subunits to map the inhibitor binding site.

What role does the complex I-like enzyme play in different D. hafniense energy conservation modes?

Proteomic analysis reveals differential expression patterns of the complex I-like enzyme across various growth conditions. The relative abundance (Z-scores) of Nuo subunits across different growth conditions shows a distinct pattern :

Growth ConditionRelative Abundance (Z-score)Metabolic Mode
Py/Fu0.7 to 0.9Respiratory with pyruvate
La/Fu0.4 to 0.7Respiratory with lactate
Py-only0.6 to 0.8Partially fermentative
La/ClOHPA-0.5 to -0.2Organohalide respiration
H₂/Fu-0.7 to -0.5H₂-based respiration
H₂/ClOHPA-1.0 to -0.8H₂-driven OHR

This pattern suggests complex I involvement varies with metabolic mode, being more critical when organic electron donors (pyruvate, lactate) are used compared to hydrogen.

How does nuoK function alongside other electron transport components identified in D. hafniense?

Proteomic analysis identified potential functional partners of the complex I-like enzyme based on similar expression patterns . These include:

  • Pyruvate ferredoxin oxidoreductase (ACL18023) - likely provides electrons when pyruvate is the electron donor

  • Ferredoxin (ACL21378) - potentially shuttles electrons between PFOR and complex I

  • Additional redox proteins showing similar abundance profiles

Researchers should investigate these interactions through co-purification studies and reconstitution experiments measuring electron transfer rates between purified components.

How does nuoK activity relate to D. hafniense adaptations to different environmental conditions?

D. hafniense displays remarkable metabolic versatility, adapting to various environmental electron donors and acceptors . The up-regulation patterns of nuoK and other complex I components under specific conditions suggest this complex plays variable roles depending on available substrates. Researchers should design competition experiments between wild-type and nuoK-modified strains under different growth conditions to quantify fitness effects.

What mechanisms coordinate nuoK expression with other metabolic pathways in D. hafniense?

The expression profile of nuoK appears coordinated with other metabolic components, including pyruvate ferredoxin oxidoreductase and ferredoxin . To understand this coordination, researchers should perform integrated transcriptomic and proteomic analyses, particularly focusing on potential transcriptional regulators that might co-regulate these systems. Time-course studies during metabolic shifts could reveal the sequential activation of these components.

How is nuoK involved in the dissimilatory sulfite reduction pathway in D. hafniense?

Proteomic analysis revealed that addition of sodium sulfide as a reducing agent triggered expression of the dissimilatory sulfite reduction pathway in D. hafniense, particularly under fermentative growth on pyruvate, H₂ respiration, and organohalide respiration conditions . Researchers should investigate whether electron flow through the complex I-like enzyme connects to this pathway, possibly by comparing redox balances in wild-type versus nuoK-modified strains.

How does D. hafniense nuoK compare to homologs in obligate organohalide-respiring bacteria?

Unlike obligate organohalide-respiring bacteria such as Dehalococcoides mccartyi, D. hafniense shows metabolic flexibility with varied electron donors and acceptors . Comparative analysis of nuoK from these organisms might reveal adaptations related to this metabolic versatility. Researchers should perform detailed sequence and structural comparisons, followed by functional complementation studies in appropriate host systems.

What can we learn from comparing nuoK expression patterns across Desulfitobacterium species?

Additional experiments with D. hafniense strain TCE1 showed similar rotenone sensitivity patterns to strain DCB-2, with growth inhibition when using lactate but less affected when using hydrogen . This suggests conserved complex I function across strains. Researchers should extend these comparisons to additional Desulfitobacterium species and strains to establish whether nuoK expression patterns correlate with specific metabolic capabilities.

How does nuoK function in comparison to alternative NADH-oxidizing enzymes in D. hafniense?

D. hafniense possesses multiple redox enzyme families , suggesting potential redundancy in electron transport chains. Researchers should investigate whether alternative NADH-oxidizing enzymes exist and how they interact functionally with the complex I-like enzyme. Deletion studies targeting specific components followed by growth phenotyping under various conditions would reveal the degree of redundancy and specialization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.