Recombinant Desulfitobacterium hafniense Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Description

Introduction

Ribonuclease Y (Rny) is an enzyme that belongs to the ribonuclease family, which is involved in RNA processing and degradation in bacteria. Recombinant Rny refers to the Rny enzyme that is produced using recombinant DNA technology, typically in a host organism like E. coli . Desulfitobacterium hafniense is a bacterium known for its ability to reductively dechlorinate organic compounds, and its Rny enzyme is of interest due to its potential role in the bacterium's survival and adaptation to various environmental conditions .

Characteristics of Recombinant Desulfitobacterium hafniense Rny

CharacteristicDescription
Source OrganismDesulfitobacterium hafniense
TypeRibonuclease Y (Rny)
Production MethodRecombinant expression in a host organism (e.g., E. coli)
Molecular WeightVaries depending on the specific Rny variant and any tags added for purification
PurityTypically >90% as determined by SDS-PAGE for commercial preparations
TagOften includes a His-tag for purification via immobilized metal affinity chromatography (IMAC)
FormUsually provided as a lyophilized powder
Storage BufferTris/PBS-based buffer with added stabilizers (e.g., trehalose)
ReconstitutionReconstitute in deionized sterile water; glycerol may be added for long-term storage

Production and Purification

Recombinant Rny is produced by cloning the rny gene from Desulfitobacterium hafniense into an expression vector and transforming it into a host organism like E. coli . The host cells are then cultured under conditions that promote high-level expression of the Rny protein. To facilitate purification, a tag such as a His-tag is often added to the Rny protein . The protein can then be purified using affinity chromatography, followed by size exclusion chromatography to ensure homogeneity.

Function and Mechanism

Rny is a ribonuclease, meaning it cleaves RNA molecules. The specific function of Rny in Desulfitobacterium hafniense is not yet fully understood, but it is likely involved in mRNA turnover, rRNA processing, or stress response .

Applications

While the study of Rny from Desulfitobacterium hafniense is still in its early stages, potential applications include:

  • RNA Biochemistry Research: Studying the structure, function, and regulation of Rny .

  • Synthetic Biology: Utilizing Rny in RNA-based circuits or as a tool for controlling gene expression .

  • Enzyme Engineering: Modifying Rny to alter its substrate specificity or activity for biotechnological applications .

  • Environmental Microbiology: Understanding the role of Rny in the adaptation of Desulfitobacterium hafniense to different environmental conditions .

Research Findings

  • Heterologous Production: Functional expression of Desulfitobacterium hafniense enzymes, including reductive dehalogenases, has been achieved in other bacterial species like Shimwellia blattae . This approach can be used to study Rny function and regulation.

  • Metabolic Versatility: Desulfitobacterium hafniense exhibits metabolic versatility, enabling it to degrade various aromatic compounds . Rny may play a role in the regulation of gene expression during the degradation of these compounds.

  • Genetic Code Expansion: Genetic code expansion (GCE) technologies can be used to incorporate non-canonical amino acids into Rny, potentially altering its activity or stability .

  • Cobamide Biosynthesis: Desulfitobacterium hafniense can synthesize cobamides de novo, which are important cofactors for reductive dehalogenases . Rny may be involved in the regulation of cobamide biosynthesis.

Future Directions

Further research is needed to fully elucidate the function of Rny in Desulfitobacterium hafniense and its potential applications. Areas of interest include:

  • Determining the crystal structure of Rny to understand its mechanism of action.

  • Identifying the specific RNA substrates of Rny in Desulfitobacterium hafniense.

  • Investigating the regulation of rny gene expression under different environmental conditions.

  • Exploring the potential of Rny as a tool for RNA manipulation in biotechnology and synthetic biology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
rny; DSY1941; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-524
Protein Length
full length protein
Species
Desulfitobacterium hafniense (strain Y51)
Target Names
rny
Target Protein Sequence
MCLGGENYLELTELIFIVVAVVVSLFVGGFIGWLIRKSAAEKLIGSAEEEAKRVIDNAQG AAEAKRREAVIAAKEEVMHIRNEVEKESRERRNEIQRMERRVIQKEESLDRKMESLERKE DNLHRKEEEVDQLKEVLTQTVAKEKQELERVSGLSTEEAKQILLQSVEEEVRYESAIMIK DIETKAKEEAEKRAKNIISLAIQRCAADHVAESTVSVVALPSDEMKGRIIGREGRNIRTL ETLTGIDLIIDDTPEAVILSGFDPIRREVARVALEKLIADGRIHPARIEEMVEKSQKEVD QRIREEGEQATFETGVHGLHPEIIRLLGRLKFRTSYGQNVLKHSMEVSHLAGLMAAELGV DVQLAKRAGLLHDLGKAVDHDTEGTHVQIGVDLAKKYKESWEVIHAIEAHHGDVEAKTIE AVLVAAADAVSAARPGARRETLESYIKRLQKLEEIADTYDGVEKSYAIQAGREIRIIVRP DKIDDVLAPKVAREISKRIEDELEYPGQIKVVVIRETRAVDYAK
Uniprot No.

Target Background

Function
Endoribonuclease initiating mRNA decay.
Database Links

KEGG: dsy:DSY1941

STRING: 138119.DSY1941

Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Ribonuclease Y (rny) and what is its function in Desulfitobacterium hafniense?

Ribonuclease Y (rny) is an endoribonuclease that plays a critical role in RNA processing and decay in bacteria. In Desulfitobacterium hafniense, rny is a 524-amino acid protein that likely participates in the regulation of gene expression through mRNA degradation and processing . The protein contains a transmembrane domain at its N-terminus, suggesting it is membrane-associated, which is consistent with ribonuclease Y proteins in other bacteria. Given D. hafniense's metabolic flexibility and ability to adapt to various environmental conditions, rny likely plays an important role in post-transcriptional regulation of genes involved in processes such as reductive dehalogenation and anaerobic respiration .

What experimental considerations are important when studying the RNA substrate specificity of recombinant D. hafniense Ribonuclease Y?

Determining the RNA substrate specificity of D. hafniense Ribonuclease Y requires careful experimental design. Researchers should consider:

  • RNA substrate preparation: Generate a diverse set of RNA substrates, including those derived from genes involved in metabolic pathways specific to D. hafniense, such as reductive dehalogenation genes (pceA, rdhA3) .

  • Membrane association: Since the native enzyme is likely membrane-associated, the impact of the recombinant expression strategy (soluble His-tagged protein) on substrate specificity should be evaluated. Comparative assays between membrane-bound and soluble forms may reveal differences in activity or specificity .

  • Influence of physiological conditions: D. hafniense demonstrates remarkable metabolic flexibility, adapting to various electron donors and acceptors . Researchers should test rny activity under different pH, salt concentrations, and redox conditions to understand how environmental factors influence substrate recognition.

  • Competitive inhibition assays: Design RNA substrates with varying secondary structures to determine structural preferences in substrate recognition, using competitive binding assays to quantify relative affinities.

  • Comparison with related ribonucleases: Include parallel experiments with ribonucleases from related organisms to identify D. hafniense-specific substrate preferences.

How might Ribonuclease Y activity contribute to D. hafniense's metabolic flexibility and environmental adaptation?

D. hafniense demonstrates remarkable metabolic versatility, capable of utilizing multiple electron donors (lactate, formate, pyruvate) and acceptors (sulfate, nitrate, fumarate, organohalides) . This metabolic flexibility likely requires sophisticated regulation of gene expression, in which Ribonuclease Y may play a crucial role:

  • Transcriptome remodeling: Ribonuclease Y could regulate the stability of mRNAs encoding metabolic enzymes, facilitating rapid shifts between metabolic pathways in response to changing environmental conditions .

  • Stress response mediation: Under electron donor (lactate) or electron acceptor (fumarate) limitation, D. hafniense alters its physiology significantly . Ribonuclease Y may selectively degrade certain transcripts while preserving others, contributing to stress adaptation.

  • Regulation of reductive dehalogenation: The expression of reductive dehalogenases (such as RdhA3) is induced under specific conditions . Ribonuclease Y could participate in post-transcriptional regulation of these genes, fine-tuning their expression according to substrate availability.

  • Control of ribosomal RNA processing: D. hafniense strains show heterogeneity in their 16S rRNA genes due to insertions of 100-200 bp that form stable loops when transcribed . Ribonuclease Y might be involved in processing these unusual ribosomal RNA structures, potentially affecting translation efficiency under different conditions.

What approaches can be used to investigate the potential role of D. hafniense Ribonuclease Y in regulating reductive dehalogenation pathways?

To investigate the role of Ribonuclease Y in regulating reductive dehalogenation pathways, researchers should consider:

  • Gene knockout/knockdown studies: Generate rny knockout or knockdown mutants in D. hafniense and analyze changes in:

    • Growth kinetics with organohalides as electron acceptors

    • Expression levels of reductive dehalogenase genes (pceA, rdhA3)

    • Dechlorination rates of compounds like 2,4,5-TCP and PCE

  • RNA stability assays: Compare the half-lives of reductive dehalogenase mRNAs in wild-type versus rny-mutant strains to determine if these transcripts are direct targets of Ribonuclease Y.

  • RNA immunoprecipitation: Identify RNAs that physically interact with Ribonuclease Y using RNA immunoprecipitation followed by sequencing (RIP-seq).

  • Transcriptome-wide analysis: Employ RNA-seq to compare transcriptome profiles between wild-type and rny-mutant strains under conditions that induce reductive dehalogenation, such as exposure to 2,4,5-TCP .

  • In vitro RNA degradation assays: Test whether purified recombinant Ribonuclease Y directly degrades transcripts of reductive dehalogenase genes and their regulators.

What are the optimal conditions for expressing and purifying recombinant D. hafniense Ribonuclease Y?

Based on established protocols for recombinant D. hafniense protein expression, the following methodological approach is recommended:

Expression Protocol:

  • Expression vector: Use a vector with an N-terminal His-tag similar to the pASK-IBA3C vector employed for D. hafniense reductive dehalogenases .

  • Host strain: E. coli BL21(DE3) or similar strains optimized for recombinant protein expression .

  • Culture conditions:

    • Medium: LB supplemented with appropriate antibiotics

    • Temperature: Induce at 25-30°C rather than 37°C to enhance protein solubility

    • Induction: 0.5-1.0 mM IPTG for T7 promoter-based systems

    • Duration: 4-6 hours post-induction for optimal yield

Purification Protocol:

  • Cell lysis: Sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, and protease inhibitors.

  • Affinity chromatography: Ni-NTA resin with stepwise elution (50 mM, 100 mM, 250 mM imidazole).

  • Size exclusion chromatography: Further purification using a Superdex 200 column to obtain homogeneous protein.

  • Storage: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT, 10% glycerol at -80°C.

How can researchers design assays to measure the catalytic activity of recombinant D. hafniense Ribonuclease Y?

To effectively measure the catalytic activity of recombinant D. hafniense Ribonuclease Y, researchers should consider the following assay designs:

Fluorescence-Based Assays:

  • Substrate preparation: Synthesize RNA oligonucleotides (20-30 nt) with a 5′-fluorophore and 3′-quencher. Cleavage by Ribonuclease Y will separate the fluorophore from the quencher, resulting in increased fluorescence.

  • Reaction conditions:

    • Buffer: 50 mM Tris-HCl (pH 7.5-8.0), 100 mM NaCl, 5 mM MgCl₂

    • Temperature: Test range from 25-50°C (D. hafniense grows optimally at 35-37°C)

    • RNA substrate: 50-200 nM

    • Enzyme concentration: 10-100 nM

  • Data analysis: Calculate initial reaction rates at different substrate concentrations to determine kinetic parameters (Km, Vmax, kcat).

Gel-Based Assays:

  • Substrate preparation: In vitro transcribe longer RNA substrates (100-500 nt) from genes of interest, including reductive dehalogenase mRNAs.

  • Reaction and analysis: Incubate RNA with purified Ribonuclease Y, resolve products on denaturing polyacrylamide gels, and visualize by SYBR Green staining or autoradiography (if using radiolabeled RNA).

  • Cleavage site mapping: Perform primer extension or RNA sequencing to identify specific cleavage sites.

What approaches can be used to identify the physiological RNA targets of D. hafniense Ribonuclease Y?

To identify the physiological RNA targets of D. hafniense Ribonuclease Y, researchers should employ a multi-faceted approach:

Transcriptome-Wide Methods:

  • CLIP-seq (Cross-linking immunoprecipitation followed by sequencing):

    • Express FLAG- or His-tagged Ribonuclease Y in D. hafniense

    • Cross-link RNA-protein complexes using UV radiation

    • Immunoprecipitate Ribonuclease Y with bound RNAs

    • Prepare libraries from purified RNAs for high-throughput sequencing

  • Differential RNA sequencing:

    • Compare transcriptome profiles between wild-type and rny-deficient D. hafniense

    • Analyze samples at multiple time points after shifting growth conditions

    • Identify transcripts with altered abundance or processing patterns

Targeted Validation Methods:

  • RNA stability assays: Measure half-lives of candidate target RNAs in wild-type versus rny-mutant strains using rifampicin to inhibit transcription, followed by RT-qPCR at various time points.

  • In vitro cleavage assays: Test direct cleavage of candidate targets by purified recombinant Ribonuclease Y.

  • Structure probing: Determine RNA structural features that might serve as recognition elements for Ribonuclease Y using chemical and enzymatic probing methods.

How can recombinant D. hafniense Ribonuclease Y be used to investigate RNA processing in anaerobic bacteria?

Recombinant D. hafniense Ribonuclease Y offers a valuable tool for investigating RNA processing in anaerobic bacteria, particularly those with unusual RNA features:

  • Comparative RNA processing studies: D. hafniense strains possess unusual 16S rRNA genes with insertions of 100-200 bp that form stable loop structures when transcribed . Recombinant Ribonuclease Y can be used to investigate whether these structures are substrates for ribonuclease processing, potentially revealing specialized RNA processing mechanisms in anaerobic bacteria.

  • Identification of RNA decay pathways: By combining recombinant Ribonuclease Y with other known ribonucleases in in vitro assays, researchers can reconstruct RNA decay pathways specific to D. hafniense and related anaerobes.

  • RNA structure-function relationships: D. hafniense's metabolic flexibility suggests complex regulatory networks . Recombinant Ribonuclease Y can help elucidate how RNA secondary structures influence transcript stability and processing in response to environmental changes.

  • Development of RNA-based regulatory tools: Understanding Ribonuclease Y's substrate preferences could lead to the development of RNA-based tools for controlling gene expression in anaerobic bacteria, with potential applications in synthetic biology and biotechnology.

What insights might D. hafniense Ribonuclease Y provide about post-transcriptional regulation in bioremediation contexts?

D. hafniense is a promising bioremediator due to its ability to perform reductive dehalogenation of environmental contaminants . Studying its Ribonuclease Y may provide several insights into post-transcriptional regulation relevant to bioremediation:

  • Stress response mechanisms: D. hafniense demonstrates metabolic adaptability under electron donor or acceptor limitation . Ribonuclease Y likely contributes to this adaptation by modulating mRNA stability in response to environmental stressors commonly encountered at contaminated sites.

  • Regulatory networks controlling dehalogenation: The RdhA3 reductive dehalogenase in D. hafniense DCB-2 shows substrate-specific induction . Understanding how Ribonuclease Y regulates reductive dehalogenase transcripts could help optimize dehalogenation processes for bioremediation applications.

  • Biofilm formation and persistence: Effective bioremediation often depends on stable biofilm communities. Ribonuclease Y may regulate transcripts involved in biofilm formation and maintenance, influencing D. hafniense's persistence in contaminated environments.

  • Interspecies RNA regulation: D. hafniense often exists in mixed microbial communities during bioremediation. Exploring whether Ribonuclease Y processes RNAs from other species could reveal mechanisms of interspecies communication relevant to bioremediation consortia performance.

How might structural studies of D. hafniense Ribonuclease Y contribute to understanding ribonuclease evolution in diverse bacterial lineages?

Structural studies of D. hafniense Ribonuclease Y could provide valuable insights into ribonuclease evolution:

  • Comparative structural analysis: D. hafniense belongs to the Firmicutes phylum , and structural comparison of its Ribonuclease Y with homologs from other phyla could reveal evolutionary adaptations specific to different bacterial lineages.

  • Structure-function relationships in extremophiles: D. hafniense thrives in anaerobic environments and demonstrates metabolic flexibility . Structural features of its Ribonuclease Y may reveal adaptations that enable RNA processing under these conditions.

  • Catalytic mechanism conservation: Determining whether the catalytic mechanism of D. hafniense Ribonuclease Y is conserved with homologs from other bacteria would contribute to understanding the evolutionary constraints on ribonuclease function.

  • Membrane association: The N-terminal region of D. hafniense Ribonuclease Y contains a predicted transmembrane domain . Structural studies could elucidate how membrane association influences enzyme activity and substrate access, potentially revealing evolutionary adaptations related to cellular compartmentalization of RNA processing.

  • Co-evolution with unusual RNA structures: Given that D. hafniense possesses unusual 16S rRNA genes with large insertions , its Ribonuclease Y may have co-evolved specific features for processing these structures. Structural studies could identify such adaptations, providing insights into co-evolution of RNA processing enzymes with their substrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.