Recombinant Desulfitobacterium hafniense UPF0365 protein Dhaf_2899 (Dhaf_2899)

What is Dhaf_2899 and what are its basic characteristics?

Dhaf_2899 is a UPF0365 protein from Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) with 333 amino acids in its full-length form . The protein is classified as part of the UPF0365 protein family, which consists of proteins with currently unknown function . The complete amino acid sequence is available and begins with MNMPIEVLMPIILLALALILISVVFTFIPVGLWISALAAGVNVGIFTLVGMRLRRVTPSR and continues through to the C-terminal sequence KVVEAESEVPRALAEALKEGKLGVMDYYTMQNIMADTSMRDNIARSSNSNTDSNPKK . This protein is identified in the UniProt database with the accession number B8FYJ9, indicating it has been cataloged but its functional characterization remains limited .

What expression systems are typically used for producing recombinant Dhaf_2899?

Recombinant Dhaf_2899 can be produced using several expression systems, with the most common being E. coli for His-tagged full-length protein and mammalian cell systems for partial protein expression . For basic research applications, E. coli expression systems offer advantages of high yield and relative simplicity, particularly suitable for structural studies and initial characterization . Mammalian expression systems may provide better post-translational modifications, potentially yielding protein with more native-like properties . When selecting an expression system, researchers should consider their experimental goals - bacterial systems for high yield and structural studies, and mammalian systems when native folding and modifications are critical for function.

What are the recommended storage and handling protocols for recombinant Dhaf_2899?

For optimal stability and activity of recombinant Dhaf_2899, the protein should be stored at -20°C, with extended storage recommended at -20°C or -80°C . The commercial preparations are typically supplied in a Tris-based buffer containing 50% glycerol, which helps maintain protein stability during freeze-thaw cycles . Repeated freezing and thawing should be strictly avoided as this can lead to protein degradation and loss of activity . For routine laboratory work, it is advisable to prepare working aliquots that can be stored at 4°C for up to one week . When reconstituting lyophilized protein, researchers should use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, and add glycerol to a final concentration of 5-50% for long-term storage . Brief centrifugation of the vial prior to opening is recommended to ensure all material is collected at the bottom of the container .

How should researchers design experiments to investigate the potential function of Dhaf_2899?

Given that Dhaf_2899 is a UPF0365 protein with unknown function, a systematic experimental approach is recommended. Begin with bioinformatic analysis using tools like BLAST, Pfam, and AlphaFold2 to identify potential structural homologs and functional domains . For wet-lab characterization, employ a combination of methods starting with localization studies using fluorescently-tagged Dhaf_2899 to determine cellular distribution patterns. Follow with pull-down assays and mass spectrometry to identify interaction partners, which can provide clues about functional pathways . Additionally, consider using knockout/knockdown approaches in model organisms to observe phenotypic effects. For prokaryotic proteins like Dhaf_2899, heterologous expression in E. coli followed by functional complementation studies can be particularly informative. Design experiments with appropriate controls including wild-type cells, cells expressing an unrelated protein of similar size, and cells with empty vector to distinguish specific effects from artifacts.

What are the recommended approaches for studying protein-protein interactions of Dhaf_2899?

To investigate protein-protein interactions of Dhaf_2899, employ both in vitro and in vivo approaches. Begin with affinity purification coupled with mass spectrometry (AP-MS) using His-tagged Dhaf_2899 as bait . For validation of interactions, use techniques such as co-immunoprecipitation, FRET (Fluorescence Resonance Energy Transfer), or biolayer interferometry. Yeast two-hybrid screening can also be utilized but may yield false positives, necessitating secondary validation methods. For structural characterization of interaction interfaces, consider hydrogen-deuterium exchange mass spectrometry (HDX-MS) or cross-linking mass spectrometry (XL-MS). When designing these experiments, it's crucial to include appropriate negative controls (such as unrelated proteins with similar characteristics) and positive controls if any known interactions exist. Consider using both N- and C-terminal tagged versions of Dhaf_2899 to minimize potential interference of the tag with interaction sites .

What methods are appropriate for structural characterization of Dhaf_2899?

For structural characterization of Dhaf_2899, researchers should consider employing a multi-technique approach. X-ray crystallography remains the gold standard for high-resolution protein structures, requiring highly purified protein (>95% purity) for crystallization trials . If crystallization proves challenging, cryo-electron microscopy (cryo-EM) offers an alternative approach, particularly effective for membrane proteins or large complexes . For initial assessment of secondary structure content and thermal stability, circular dichroism (CD) spectroscopy and differential scanning fluorimetry (DSF) provide valuable data with minimal protein consumption. Nuclear magnetic resonance (NMR) can be used for solution structure determination if the protein is stable and <30 kDa in size. Additionally, computational approaches using AlphaFold2 modeling can provide predictive structural insights, especially valuable when experimental structures are unavailable . This approach has been successfully used in recent studies to predict protein structures and match them with cellular densities observed in cryo-electron tomography .

What analytical methods can be used to assess the purity and quality of recombinant Dhaf_2899?

Multiple analytical techniques should be employed to thoroughly assess the purity and quality of recombinant Dhaf_2899. Begin with SDS-PAGE to evaluate purity, with commercial preparations typically showing >85% purity . For higher resolution analysis, use capillary electrophoresis or analytical size exclusion chromatography to detect minor contaminants and aggregates. To assess protein folding, employ circular dichroism (CD) spectroscopy for secondary structure evaluation and fluorescence spectroscopy to examine tertiary structure through intrinsic tryptophan fluorescence. For confirming protein identity and detecting post-translational modifications, mass spectrometry is essential, with techniques like peptide mass fingerprinting or intact mass analysis providing different levels of information. Dynamic light scattering (DLS) can detect the presence of aggregates and provide information on size distribution. For activity assessment, develop functional assays based on predicted functions or interact with known binding partners, even when the precise function remains unknown .

How can researchers optimize expression and purification of Dhaf_2899 for structural studies?

For structural studies requiring high-quality Dhaf_2899, optimization of expression and purification is critical. Begin by testing multiple expression constructs with variations in tags (His, GST, MBP) and their positions (N or C-terminal) . Test expression in different E. coli strains (BL21(DE3), Rosetta, Arctic Express) and optimize induction conditions by varying temperature (16-37°C), IPTG concentration (0.1-1.0 mM), and duration (4h to overnight). For membrane-associated proteins like Dhaf_2899 (suggested by its sequence containing hydrophobic regions), consider using mild detergents during lysis and purification steps . Implement a multi-step purification strategy beginning with affinity chromatography (based on the chosen tag), followed by ion exchange chromatography and size exclusion chromatography for highest purity. Throughout purification, include reducing agents (DTT or β-mercaptoethanol) to prevent disulfide bond formation and protease inhibitors to minimize degradation. Assess protein stability in various buffer conditions using thermal shift assays to identify optimal buffer composition for structural studies. For crystallization trials, perform limited proteolysis to identify stable domains if full-length protein proves recalcitrant to crystallization .

What computational and bioinformatic approaches can help predict the function of Dhaf_2899?

Given the limited experimental data on Dhaf_2899 function, computational approaches offer valuable insights. Begin with sequence-based analyses using tools like BLAST, PSI-BLAST, and HHpred to identify distant homologs with known functions. Employ protein domain prediction tools (Pfam, SMART, InterPro) to identify conserved domains that might suggest molecular function. For structural insights, use AlphaFold2 to generate accurate structural models, which can then be compared against known structures using DALI or PDBeFold to identify structural homologs . Analyze the protein's amino acid sequence for potential transmembrane regions using tools like TMHMM or Phobius, particularly important given the hydrophobic segments in Dhaf_2899's sequence . Perform conserved residue analysis across UPF0365 family members to identify potentially functionally important sites. Use tools like ConSurf to map conservation onto the predicted structure. Molecular docking and molecular dynamics simulations can provide insights into potential binding partners and conformational flexibility. For contextual information, analyze genomic context to identify functionally related genes that are co-located or co-expressed with Dhaf_2899 in Desulfitobacterium hafniense .

What are common challenges when working with recombinant Dhaf_2899 and how can they be addressed?

Researchers working with recombinant Dhaf_2899 may encounter several common challenges. Protein solubility issues often arise due to the hydrophobic regions in its sequence . To address this, try expressing at lower temperatures (16-18°C), using solubility-enhancing fusion tags like MBP or SUMO, or adding mild detergents for extraction if membrane-associated. Protein degradation during purification can be minimized by working quickly at 4°C, including protease inhibitors, and avoiding repeated freeze-thaw cycles . For aggregation problems, optimize buffer conditions by screening different pH values, salt concentrations, and additives (glycerol, arginine, trehalose). If low expression yields occur, test codon-optimized constructs for the expression host, different promoter systems, or alternative expression hosts. Difficulty in removing fusion tags cleanly can be addressed by optimizing cleavage conditions or redesigning constructs with different protease recognition sites. When addressing activity issues, ensure the protein is properly folded using techniques like circular dichroism and consider that the tag position might interfere with function, necessitating comparison of N-terminal vs. C-terminal tagged versions .

How should researchers address inconsistent or contradictory results when studying Dhaf_2899?

When faced with inconsistent or contradictory results in Dhaf_2899 research, a systematic troubleshooting approach is essential. First, verify protein identity and integrity through mass spectrometry and SDS-PAGE to ensure experiments are conducted with properly folded, full-length protein . Systematically evaluate experimental variables that might contribute to inconsistency, including protein batch variation, buffer composition differences, and experimental conditions like temperature and pH. Implement rigorous statistical analysis, using appropriate statistical tests and sufficient biological and technical replicates (minimum n=3) to differentiate real effects from random variation. Consider the influence of different expression systems - results from E. coli-expressed protein may differ from those using mammalian cell-expressed protein due to post-translational modifications or folding differences . When contradictory results persist, design experiments that directly test competing hypotheses, potentially using complementary methodologies to approach the question from different angles. Finally, be alert to potential contaminating activities from the expression system or purification process, which can be addressed by including appropriate negative controls and testing multiple purification approaches .

What statistical approaches are appropriate for analyzing data from experiments involving Dhaf_2899?

The choice of statistical approaches for Dhaf_2899 research depends on the experimental design and data characteristics. For comparing experimental groups (e.g., wild-type vs. mutant protein activity), employ appropriate parametric tests (t-test, ANOVA) if data meet normality assumptions, or non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) if not. Always perform power analysis during experimental design to ensure sufficient sample size for detecting biologically meaningful effects. When analyzing protein-protein interactions, use statistical methods that account for non-specific binding, such as significance analysis of interactome (SAINT) for mass spectrometry data . For structural studies, employ statistical validation methods specific to the technique used - R-factors and Ramachandran plots for X-ray crystallography, or resolution estimation methods for cryo-EM. When analyzing sequence-based predictions, consider the statistical significance of alignments (e-values in BLAST) and domain predictions (p-values in Pfam). For any high-throughput studies, implement appropriate multiple testing corrections (Bonferroni, Benjamini-Hochberg FDR) to control false discovery rates. Statistical consultation is recommended for complex experimental designs or when applying advanced statistical methods like Bayesian approaches or machine learning algorithms to protein function prediction .

What emerging technologies could advance our understanding of Dhaf_2899 function?

Several cutting-edge technologies hold promise for elucidating Dhaf_2899 function. Cryo-electron tomography combined with AlphaFold2 modeling represents a powerful approach for in situ structural characterization, similar to recent applications in sperm protein research . This method could identify Dhaf_2899's localization and structural interactions within the bacterial cell. AlphaFold-Multimer and RoseTTAFold could predict potential interaction partners based on structural complementarity. Single-molecule techniques such as FRET or force spectroscopy could provide insights into conformational dynamics and mechanistic function. Proximity labeling methods (BioID, APEX) in heterologous expression systems could map the protein's interaction neighborhood in living cells. For functional characterization, CRISPR interference in related model organisms or gene deletion followed by multi-omics profiling could reveal pathways affected by Dhaf_2899 absence. Native mass spectrometry techniques could identify small molecule ligands or cofactors that bind to Dhaf_2899. The integration of these advanced techniques with traditional biochemical approaches will be crucial for comprehensive functional characterization of this poorly understood protein .

How can researchers determine if Dhaf_2899 has enzymatic activity?

To investigate potential enzymatic activity of Dhaf_2899, researchers should implement a strategic experimental pipeline. Begin with computational analyses using tools like Enzyme Function Initiative-Enzyme Similarity Tool (EFI-EST) and COFACTOR to predict possible enzymatic functions based on structural similarity to known enzymes. Based on these predictions, design targeted activity assays testing for specific reaction classes. Since Dhaf_2899 is a bacterial protein with unknown function, consider testing activities relevant to bacterial metabolism, including redox reactions, hydrolysis of various substrates, and group transfer reactions. Use techniques such as differential scanning fluorimetry (DSF) to screen for potential substrates or cofactors that enhance thermal stability, indicating binding. For unbiased activity discovery, employ metabolomics approaches where purified protein is incubated with cell lysates or metabolite mixtures, followed by mass spectrometry to detect modified compounds. Test activity under various conditions (pH, temperature, salt, metal ions) as some enzymes have strict requirements for activity. For any detected activity, verify enzyme kinetics (Km, Vmax, kcat) and perform site-directed mutagenesis of predicted catalytic residues to confirm the active site. Structure determination through X-ray crystallography with bound substrates/inhibitors can provide definitive evidence of enzymatic function .

What collaborative approaches might accelerate progress in understanding Dhaf_2899?

Progress in characterizing Dhaf_2899 would benefit significantly from strategic collaborative approaches spanning multiple disciplines. Establish collaborations between structural biologists and computational biologists to integrate experimental data with advanced modeling approaches like AlphaFold2 . Partner with microbiologists specializing in anaerobic bacteria, particularly those studying Desulfitobacterium hafniense, to investigate the protein's role in its native context through gene deletion or silencing approaches. Collaborate with biochemists and enzymologists to design and implement systematic activity screening assays based on predicted functions. Engage with proteomics experts to identify interaction partners and post-translational modifications using advanced mass spectrometry techniques. Seek partnerships with systems biologists to place Dhaf_2899 within the broader metabolic and regulatory networks of its host organism. Consider establishing a consortium dedicated to characterizing proteins of unknown function (PUFs) to develop standardized approaches and share resources. Implement open science practices by sharing preliminary data, protocols, and materials through platforms like protocols.io or through preprints to accelerate discovery and prevent duplication of efforts. Multi-lab validation studies can help establish reproducible findings and overcome limitations of single-laboratory investigations .