Recombinant Desulfitobacterium hafniense UPF0365 protein DSY1747 (DSY1747)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; DSY1747; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Desulfitobacterium hafniense (strain Y51)
Target Names
DSY1747
Target Protein Sequence
MNMPIEVLMPIILLALALILISVVFTFIPVGLWISALAAGVNVGIFTLVGMRLRRVTPSR IVNPLIKAHKAGLRVTTAQLEAHYLAGGNVDRVVNALIAAERAAIPLQFERAAAIDLAGR DVLEAVQMSVNPKVIETPVVSAVAKNGIELRVKARVTVRANIDRLVGGAGEETIIARVGE GIVTSIGSSLSHEKVLENPDMVSRTVLAKGLDSGTAFEILSIDIADVDVGKNIGAQLQTD QAEADKRIAQAKAEERRAMAVAKEQEMIAYVQEMRAKVVEAESEVPRALAEALKEGKLGV MDYYTMQNIMADTSMRDNIARSSNSNTDSNPKK
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in maintaining membrane fluidity.

Database Links

KEGG: dsy:DSY1747

STRING: 138119.DSY1747

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What is Desulfitobacterium hafniense UPF0365 protein DSY1747?

DSY1747 (also known as FloA) is a protein encoded by the DSY1747 gene in Desulfitobacterium hafniense, an anaerobic Gram-positive bacterium belonging to the phylum Firmicutes . The protein is classified as a member of the UPF0365 protein family and is annotated as a Flotillin-like protein (FloA) . Desulfitobacterium hafniense has been extensively studied for its metabolic versatility, particularly its ability to utilize organohalides as electron acceptors, making it valuable for bioremediation applications .

The recombinant form of this protein is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification and detection in experimental settings . The full-length protein consists of 333 amino acids and is available commercially for research purposes.

How should recombinant DSY1747 protein be stored and handled for optimal stability?

Proper storage and handling of recombinant DSY1747 is critical for maintaining its integrity and functionality in research applications. Based on available product information, the following recommendations should be followed:

Storage ParameterRecommendation
Long-term storage-20°C to -80°C in aliquots
Working storage4°C for up to one week
Storage bufferTris/PBS-based buffer, pH 8.0 with 6% Trehalose or 50% glycerol
FormLyophilized powder
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Additional considerationsAvoid repeated freeze-thaw cycles

For optimal reconstitution of lyophilized protein :

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard) for long-term storage

  • Create multiple small aliquots to minimize freeze-thaw cycles

What experimental design principles should be considered when studying DSY1747 protein?

When designing experiments to investigate DSY1747 function, researchers should follow systematic experimental design principles to ensure valid and reproducible results :

  • Clear definition of variables:

    • Independent variables: Factors you will manipulate (e.g., protein concentration, environmental conditions)

    • Dependent variables: Outcomes you will measure (e.g., membrane association, protein interactions)

    • Control variables: Factors to keep constant across experimental conditions

  • Formulation of specific, testable hypotheses based on DSY1747's classification as a Flotillin-like protein and its bacterial context

  • Implementation of appropriate controls:

    • Positive controls (known flotillin proteins with established functions)

    • Negative controls (buffer-only conditions or inactive protein variants)

    • Vehicle controls (all components except the protein of interest)

  • Adequate replication and randomization:

    • Biological replicates (different protein preparations)

    • Technical replicates (repeated measurements)

    • Randomized treatment order to minimize bias

  • Statistical analysis planning prior to experimentation:

    • Power analysis to determine sample size

    • Selection of appropriate statistical tests based on data distribution

    • Consideration of multiple testing corrections when appropriate

Since DSY1747 is a membrane-associated protein, special considerations for membrane protein studies should be incorporated, including the use of appropriate detergents or lipid environments to maintain native structure and function .

What techniques are appropriate for investigating the function of DSY1747?

Given the nature of DSY1747 as a putative membrane protein with flotillin-like properties, several techniques are particularly suitable for functional investigations:

TechniqueApplication for DSY1747 Research
Membrane fractionationConfirming membrane localization and determining specific membrane domains
Fluorescence microscopyCellular localization using fluorescently-tagged constructs
Bacterial two-hybrid assaysIdentification of protein-protein interactions
Lipid binding assaysDetermining lipid specificity and membrane interaction domains
Site-directed mutagenesisStructure-function relationship studies of key residues
Circular dichroismSecondary structure analysis and conformational changes
Mass spectrometryIdentification of post-translational modifications and interaction partners
Co-immunoprecipitationValidation of protein-protein interactions using the His-tag
Bacterial geneticsPhenotypic analysis of gene knockouts or complementation studies

When applying these techniques, researchers should consider the bacterial origin of DSY1747 and adapt protocols accordingly. For instance, membrane extraction conditions suitable for bacterial membrane proteins may differ from those used for eukaryotic membrane proteins .

How can researchers validate the purity and activity of recombinant DSY1747?

Validating both the purity and functional activity of recombinant DSY1747 is essential before proceeding with detailed studies:

Purity Assessment:

  • SDS-PAGE analysis: According to product specifications, purity should be >90%

  • Western blot using anti-His antibodies to confirm identity and integrity

  • Mass spectrometry to verify molecular weight and sequence coverage

Functional Validation:
Since DSY1747 is annotated as a Flotillin-like protein, functional validation should focus on characteristic activities of bacterial flotillins:

  • Membrane association assays:

    • Liposome binding assays with defined lipid compositions

    • Membrane flotation assays to confirm affinity for specific membrane domains

    • Detergent resistance assays to assess microdomain association

  • Oligomerization assessment:

    • Native-PAGE or BN-PAGE to detect oligomeric states

    • Size-exclusion chromatography to determine molecular size in solution

    • Chemical crosslinking followed by SDS-PAGE to capture transient interactions

  • Protein-protein interaction studies:

    • Pull-down assays using the His-tag to identify binding partners

    • Surface plasmon resonance to measure binding kinetics

    • Fluorescence resonance energy transfer (FRET) for proximity analysis

How does DSY1747 relate to the biology of Desulfitobacterium hafniense?

Understanding the biological context of DSY1747 within Desulfitobacterium hafniense requires consideration of this organism's unique characteristics:

Desulfitobacterium hafniense is an anaerobic bacterium known for its metabolic versatility, particularly its ability to use organohalides as electron acceptors through reductive dehalogenation . The organism has been studied extensively for its potential applications in bioremediation of chlorinated pollutants. Several strains of D. hafniense have been sequenced, including strains Y51, DCB-2, and PCE-S .

As a Flotillin-like protein, DSY1747 likely contributes to membrane organization and potentially influences:

  • Cell envelope integrity under various environmental conditions

  • Organization of membrane proteins involved in electron transport chains

  • Signaling processes related to detection of environmental conditions

  • Adaptation to stress conditions encountered during organohalide respiration

The relationship between DSY1747 and the reductive dehalogenase systems that characterize D. hafniense remains an open research question. Investigations into co-localization or functional interactions between DSY1747 and components of reductive dehalogenase complexes could provide valuable insights into the organism's unique metabolic capabilities .

What approaches can be used to investigate potential protein-protein interactions of DSY1747?

Identifying the interaction partners of DSY1747 is crucial for understanding its function in cellular processes. Several complementary approaches can be employed:

  • Affinity-based methods:

    • His-tag pull-down assays followed by mass spectrometry

    • Co-immunoprecipitation with anti-DSY1747 antibodies

    • Tandem affinity purification to identify stable complexes

  • Proximity-based methods:

    • Bacterial two-hybrid screening against genomic libraries

    • Photo-crosslinking with unnatural amino acids incorporated at specific positions

    • Proximity-dependent biotin identification (BioID) adapted for bacterial systems

  • Biophysical methods:

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for protein-protein affinity measurements

  • In vivo approaches:

    • Fluorescence colocalization microscopy

    • Genetic interaction screening (e.g., synthetic lethality)

    • Suppressor screening to identify functional relationships

When interpreting interaction data, researchers should consider the membrane localization of DSY1747 and ensure that experimental conditions preserve membrane-dependent interactions that may be critical for physiological function.

What are the challenges in expressing and purifying functional DSY1747 for structural studies?

Obtaining sufficient quantities of properly folded DSY1747 for structural investigations presents several challenges typical of membrane-associated proteins:

ChallengePotential Solution
Membrane association leading to low solubilityOptimize detergent selection (DDM, LDAO, etc.) for extraction
Potential misfolding during overexpressionLower induction temperature (16-25°C) and extend expression time
Aggregation during purificationInclude appropriate stabilizers in buffers (glycerol, specific lipids)
Loss of function due to detergent extractionConsider nanodisc or liposome reconstitution after purification
Low expression yieldsTest different expression hosts (E. coli C41/C43 for membrane proteins)
Tag interference with functionCompare N-terminal vs. C-terminal tag placement
Protein heterogeneityImplement multi-step purification (IMAC followed by SEC)

Based on available product information, DSY1747 has been successfully expressed in E. coli with an N-terminal His-tag . Researchers replicating this expression should pay particular attention to:

  • Expression vector selection and promoter strength

  • Codon optimization for the expression host

  • Cell lysis conditions to efficiently extract membrane-associated proteins

  • Buffer composition throughout purification to maintain stability

  • Quality control testing to verify proper folding and functionality

How can researchers design experiments to elucidate the structure-function relationship of DSY1747?

Investigating the relationship between DSY1747 structure and its functional properties requires a systematic approach combining molecular, biochemical, and biophysical methods:

  • Sequence-based analysis:

    • Identification of conserved domains through multiple sequence alignments with other bacterial flotillins

    • Secondary structure prediction to identify potential functional regions

    • Hydrophobicity analysis to identify membrane-interacting segments

  • Targeted mutagenesis studies:

    • Alanine-scanning mutagenesis of conserved residues

    • Domain deletion or swapping experiments

    • Introduction of specific mutations based on sequence conservation

  • Functional assays for mutant proteins:

    • Membrane binding properties compared to wild-type

    • Oligomerization capability assessment

    • Protein-protein interaction profile changes

  • Structural characterization attempts:

    • Limited proteolysis to identify stable domains

    • Hydrogen-deuterium exchange mass spectrometry to map surface accessibility

    • Cryo-electron microscopy of membrane-reconstituted protein

    • X-ray crystallography trials of soluble domains

  • In vivo complementation studies:

    • Expression of mutant variants in DSY1747 knockout strains

    • Phenotypic analysis under various growth conditions

    • Localization studies using fluorescent protein fusions

By systematically correlating structural features with functional outcomes, researchers can develop a comprehensive understanding of how DSY1747's molecular architecture supports its cellular roles in Desulfitobacterium hafniense.

What statistical approaches are appropriate for analyzing DSY1747 experimental data?

For comparative studies (e.g., wild-type vs. mutant DSY1747):

  • t-tests for normally distributed data comparing two conditions

  • ANOVA for comparing multiple conditions, followed by appropriate post-hoc tests

  • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normally distributed data

For correlation studies (e.g., relating protein concentration to activity):

  • Pearson correlation for linear relationships between normally distributed variables

  • Spearman correlation for non-parametric relationships

  • Regression analysis to develop predictive models

For time-course experiments:

  • Repeated measures ANOVA

  • Mixed-effects models to account for multiple sources of variation

  • Time series analysis for dynamic processes

When designing experiments and planning statistical analyses, researchers should:

  • Perform power analysis to determine appropriate sample size

  • Include biological and technical replicates

  • Establish clear criteria for outlier identification and handling

  • Consider multiple testing corrections when performing numerous comparisons

  • Pre-register analysis plans when possible to avoid post-hoc bias

How can researchers reconcile contradictory findings about DSY1747 function?

When confronted with contradictory results regarding DSY1747 function, researchers should employ a systematic approach to reconciliation:

  • Methodological comparison:

    • Examine differences in protein preparation (tags, expression systems)

    • Compare experimental conditions (buffer composition, temperature, pH)

    • Assess detection methods and their sensitivities

    • Evaluate the specificity of reagents used

  • Biological context considerations:

    • Different strains of Desulfitobacterium hafniense may show variations

    • Growth conditions might influence protein behavior

    • Potential post-translational modifications affecting function

    • Interactions with other cellular components

  • Technical validation approaches:

    • Reproduce key experiments using standardized protocols

    • Employ complementary techniques to verify findings

    • Collaborate with laboratories reporting contradictory results

    • Perform meta-analysis of available data when sufficient studies exist

  • Proposed reconciliation framework:

    • Develop models that accommodate apparently contradictory findings

    • Consider conditional functionality depending on cellular context

    • Identify boundary conditions that determine when different behaviors occur

    • Design critical experiments to test unifying hypotheses

The scientific literature suggests that membrane proteins like DSY1747 often display context-dependent functions, which may explain apparent contradictions in experimental findings .

What are the current knowledge gaps regarding DSY1747 structure and function?

Despite the availability of recombinant DSY1747 for research, significant knowledge gaps remain:

  • Structural characterization:

    • High-resolution three-dimensional structure is not available

    • Membrane topology and domain organization remain unclear

    • Oligomerization interfaces have not been mapped

    • Lipid-binding sites are undetermined

  • Functional characterization:

    • Precise molecular function remains largely undefined

    • Role in Desulfitobacterium hafniense physiology is not well-established

    • Potential connection to the organism's unique metabolic capabilities (organohalide respiration) is unexplored

    • Conditions affecting expression and activity are poorly characterized

  • Interaction network:

    • Protein-protein interaction partners are largely unknown

    • Relationship to other membrane components requires investigation

    • Potential involvement in multiprotein complexes needs exploration

  • Regulatory mechanisms:

    • Transcriptional and post-transcriptional regulation remains unclear

    • Post-translational modifications and their effects are unexplored

    • Environmental signals influencing DSY1747 function are not characterized

Addressing these knowledge gaps requires integrative approaches combining structural biology, biochemistry, genetics, and systems biology perspectives.

What emerging technologies could advance our understanding of DSY1747?

Several cutting-edge technologies hold promise for elucidating DSY1747 structure, function, and biological roles:

  • Structural biology advancements:

    • Cryo-electron microscopy for membrane protein structures

    • Integrative structural modeling combining multiple data sources

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Solid-state NMR for membrane protein structures in native-like environments

  • Functional genomics approaches:

    • CRISPR-Cas9 genome editing in Desulfitobacterium hafniense

    • RNA-Seq to identify transcriptional networks involving DSY1747

    • Tn-Seq for functional genetic interactions

    • Ribosome profiling for translational regulation

  • Advanced imaging techniques:

    • Super-resolution microscopy for membrane organization

    • Single-molecule tracking to monitor dynamics

    • Correlative light and electron microscopy for contextual localization

    • Expansion microscopy for improved spatial resolution

  • Systems biology integration:

    • Multi-omics data integration to place DSY1747 in cellular networks

    • Metabolic flux analysis to connect to organohalide respiration

    • Computational modeling of membrane domains and protein interactions

    • Machine learning approaches to predict function from sequence and structure

By leveraging these emerging technologies, researchers can develop a more comprehensive understanding of DSY1747's role in bacterial membrane organization and cellular function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.