Recombinant Desulfobacterium autotrophicum Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant HtpX is a full-length, His-tagged protease homolog derived from Desulfobacterium autotrophicum, a sulfate-reducing bacterium. This protein is produced in E. coli expression systems and purified for biochemical and structural studies . It belongs to the HtpX family of membrane-anchored metalloproteases implicated in protein quality control and stress response .

Primary Sequence and Domains

  • Amino Acid Sequence: Comprises 309 residues (UniProt ID: C0QEI1) with a conserved zinc-binding motif critical for proteolytic activity .

  • Tags: N-terminal His tag for affinity purification .

  • Post-Translational Features: Predicted transmembrane domains and cytoplasmic protease-active sites .

PropertyDetails
SpeciesDesulfobacterium autotrophicum (strain HRM2)
Expression HostE. coli
Molecular Weight~35 kDa (calculated)
TagN-terminal hexahistidine (His<sub>6</sub>)
Purity>90% (SDS-PAGE)

Biological Role

HtpX collaborates with AAA+ proteases (e.g., FtsH) to degrade misfolded membrane proteins, preventing cytotoxicity under stress . Key findings include:

  • Substrate Specificity: Cleaves SecY (a membrane translocon) and casein in vitro .

  • Quality Control: Participates in lipopolysaccharide (LPS) transport by assisting LptD/E assembly in the outer membrane .

  • Stress Response: Upregulated under aminoglycoside exposure to mitigate protein misfolding .

Mechanistic Studies

  • Zinc Dependency: Purified HtpX requires Zn<sup>2+</sup> for self-cleavage and substrate degradation .

  • Disulfide Bond Regulation: Interacts with LptD to ensure proper disulfide isomerization during outer membrane protein biogenesis .

Functional CharacteristicEvidence
Proteolytic ActivityConfirmed via casein hydrolysis and SecY cleavage assays .
Membrane LocalizationAnchored to the cytoplasmic membrane with periplasmic protease domains .
Collaborative RoleEnhances β-barrel protein assembly (e.g., LptD) with BepA .

Expression Systems

  • Host: E. coli BL21(DE3) optimized for membrane protein expression .

  • Detergent Use: Octyl-β-d-glucoside for extraction and refolding .

Purification Workflow

  1. Affinity Chromatography: Cobalt-based resin for His-tagged protein .

  2. Anion Exchange: Further purification in detergent-containing buffers .

  3. Size-Exclusion Chromatography: Final polishing step .

Research Applications

  • Enzymology: Studying zinc metalloprotease mechanisms and substrate recognition .

  • Membrane Biology: Investigating LPS transport and outer membrane protein folding .

  • Antibiotic Adjuvant Development: Targeting HtpX to sensitize bacteria to aminoglycosides .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development according to your request.
Synonyms
htpX; HRM2_22250; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2)
Target Names
htpX
Target Protein Sequence
MGNKIRTTVLLAAMTALMMIIGQMLGGRQGMMIALIFAGVMNFASYWYSDKIVLKMYQAR EITPESAHGLYAIVQRLVQRANLPMPRIFIIPQDTPNAFATGRNPDHAVVAVTEGLLNLL DEQEITGVLAHELAHVKNRDILIGTIAATMAGAIMMLASMARWGAIFGGTRSSDDEGGSS VIGLIALSIIAPMAAMVIQMAISRSREYLADATGAAISGNPEGLASALEKLGTYSKQIPM RANPSTAHIFTVSPLSGTTLMNLFSTHPPLESRIARLRHGSDSGTGNRDSSIRRRNMNTE AKAAWDRLR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Desulfobacterium autotrophicum HRM2 and its significance in research?

Desulfobacterium autotrophicum HRM2 is a sulfate-reducing bacterium belonging to the metabolically versatile Desulfobacteriaceae family. These organisms are abundant in marine sediments and contribute significantly to the global carbon cycle through complete oxidation of organic compounds . D. autotrophicum HRM2 has a relatively large genome of approximately 5.6 megabasepairs, which is about 2 Mbp larger than other sequenced sulfate reducers . This bacterium is particularly interesting for research because:

  • It demonstrates considerable metabolic versatility with genes for degrading various organic compounds including long-chain fatty acids

  • It possesses the Wood-Ljungdahl pathway, enabling complete oxidation of acetyl-CoA to CO₂ and chemolithoautotrophic growth

  • It contains more than 250 proteins from sensory/regulatory protein families that enable adaptation to changing environmental conditions

  • It represents an important model organism for understanding the biogeochemical sulfur cycle

What is HtpX protease and what do we know about its function?

HtpX is a membrane-bound zinc metalloprotease that belongs to the M48 family of zinc metalloproteinases . Based on studies in Escherichia coli, HtpX has been characterized as a protease involved in the quality control of membrane proteins, working in conjunction with FtsH, a membrane-bound ATP-dependent protease .

Key functional characteristics of HtpX include:

  • It exhibits proteolytic activities against both membrane and soluble proteins

  • It undergoes self-degradation upon cell disruption or membrane solubilization

  • It requires zinc for enzymatic activity, confirming its identity as a zinc-dependent endoprotease

  • In E. coli, it has been shown to cleave SecY, a membrane protein, both in vitro and in vivo

  • It plays a crucial role in eliminating malfolded and/or misassembled membrane proteins that could disturb membrane structure and function

While the D. autotrophicum HtpX homolog has not been characterized in the same detail, it is expected to share similar structural and functional properties based on sequence homology.

What is the structural organization of HtpX in bacterial systems?

Based on research with the E. coli homolog, HtpX is an integral membrane protein with multiple hydrophobic regions serving as transmembrane segments. In E. coli, HtpX has four hydrophobic regions (H1-H4), although there has been some controversy regarding whether the two C-terminal regions are truly embedded in the membrane .

The protein likely adopts a specific topology within the membrane with:

  • The proteolytic domain containing the zinc-binding motif

  • Multiple membrane-spanning regions anchoring the protein

  • Domains positioned to access substrates in different cellular compartments

E. coli HtpX contains the characteristic zinc-binding motif of metalloproteases, which is essential for its catalytic activity as demonstrated by the requirement for zinc supplementation to restore proteolytic function after purification with a zinc chelator .

How does the zinc-dependent catalytic mechanism of HtpX function?

The catalytic mechanism of HtpX relies on its zinc metalloprotease activity. Based on studies with E. coli HtpX, the following mechanistic insights are available:

  • HtpX undergoes self-degradation during cell disruption or membrane solubilization, suggesting active catalytic capabilities even under these conditions

  • When purified under denaturing conditions with a zinc chelator and then refolded, HtpX exhibits self-cleavage activity only upon zinc supplementation

  • In the presence of zinc, HtpX can degrade model substrates like casein as well as physiologically relevant membrane proteins like SecY

The zinc atom in the active site likely coordinates with conserved amino acid residues (typically histidines) and activates a water molecule for nucleophilic attack on the peptide bond of the substrate. Researchers investigating the specific catalytic residues in D. autotrophicum HtpX would need to perform site-directed mutagenesis of predicted active site residues and assess the impact on proteolytic activity.

What methodologies have been developed to study HtpX activity in vivo?

For studying HtpX activity in living cells, researchers have developed several innovative approaches:

  • An in vivo semiquantitative and convenient protease activity assay system has been established for E. coli HtpX using a specifically constructed model substrate called XMS1 (HtpX Model Substrate 1)

  • This system enables detection of differential protease activities of HtpX mutants carrying mutations in conserved regions

  • The assay likely involves monitoring the cleavage of the model substrate through techniques such as western blotting to detect the appearance of cleavage products (e.g., CL-C and CL-N fragments)

  • Such methodologies could be adapted to study the D. autotrophicum HtpX homolog by constructing similar model substrates

This type of assay system is particularly valuable for investigating the functions of HtpX and its homologs in various bacteria, allowing for comparative studies across species .

How do environmental factors affect HtpX expression and activity in sulfate-reducing bacteria?

While specific data on environmental regulation of HtpX in D. autotrophicum is limited in the provided sources, we can draw some insights from related proteases:

  • In Synechocystis PCC6803, Deg proteases (another family of proteases) show transcriptionally distinct but overlapping responses to environmental stresses: all respond to light-dark transitions; some respond to salt stress, high light, or cold shock

  • Given that D. autotrophicum HRM2 possesses more than 250 sensory/regulatory proteins enabling adaptation to changing environmental conditions , its proteolytic systems including HtpX likely respond to relevant environmental factors

  • The extensive metabolic versatility of D. autotrophicum suggests that protein quality control systems would be crucial for adaptation to varying energy sources and electron acceptors

Researchers studying environmental regulation of D. autotrophicum HtpX should consider examining:

  • Expression patterns under different sulfate concentrations

  • Response to oxidative stress

  • Adaptation to temperature variations relevant to marine sediment environments

  • Changes in expression during shifts between heterotrophic and autotrophic growth

What are the optimal conditions for expressing and purifying active recombinant D. autotrophicum HtpX?

Based on the experience with E. coli HtpX and the available recombinant D. autotrophicum HtpX , the following approach is recommended:

Expression:

  • Use an E. coli expression system with an inducible promoter

  • Include a His-tag for purification purposes

  • Consider expression at lower temperatures (16-25°C) to improve folding

  • Use a zinc-depleted medium or include a zinc chelator to prevent premature self-degradation

Purification:

  • Purify under denaturing conditions with a zinc chelator to prevent self-cleavage during extraction

  • Use immobilized metal affinity chromatography (IMAC) leveraging the His-tag

  • Conduct controlled refolding by gradual dilution or dialysis in the presence of appropriate detergents

  • Supplement with zinc only when enzymatic activity is required for functional studies

This strategy addresses the dual challenges of purifying a membrane protein while preventing its autocatalytic degradation, which has been successful for the E. coli homolog .

How can researchers develop reliable assays to measure D. autotrophicum HtpX proteolytic activity?

Researchers can develop several complementary assays to characterize the proteolytic activity of D. autotrophicum HtpX:

In vitro assays:

  • Self-cleavage assay: Monitor the appearance of degradation products from purified HtpX after zinc addition using SDS-PAGE and western blotting

  • Substrate degradation assay: Measure the cleavage of model substrates like casein or specific membrane proteins using SDS-PAGE, western blotting, or fluorescence-based detection

  • Zinc-dependence assay: Compare activity in the presence of various concentrations of zinc and other divalent cations to confirm metalloprotease characteristics

In vivo assays:

  • Adapt the XMS1 model substrate system developed for E. coli HtpX

  • Engineer fusion proteins with reporters (e.g., GFP) that change cellular localization or fluorescence properties upon cleavage

  • Perform complementation studies in HtpX-deficient strains to assess function

These assays should be performed under varying conditions (pH, temperature, ionic strength) to determine the optimal parameters for enzymatic activity.

What approaches can be used to identify physiological substrates of HtpX in D. autotrophicum?

Identification of natural substrates remains a significant challenge in protease research. For D. autotrophicum HtpX, researchers could employ:

Comparative proteomics:

  • Compare the proteome of wild-type and HtpX-deficient D. autotrophicum strains

  • Identify proteins that accumulate in the absence of HtpX, particularly membrane proteins

  • Use stable isotope labeling to monitor protein turnover rates in both strains

Substrate trapping:

  • Generate catalytically inactive HtpX mutants that can bind but not cleave substrates

  • Use affinity purification coupled with mass spectrometry to identify trapped proteins

  • Validate potential substrates through in vitro cleavage assays with purified components

Bioinformatic prediction:

  • Analyze the D. autotrophicum proteome for proteins containing sequence motifs similar to known HtpX substrates like SecY

  • Focus on membrane proteins likely to undergo quality control

  • Prioritize candidates for experimental validation

How does HtpX contribute to the unique metabolic capabilities of D. autotrophicum?

D. autotrophicum's metabolic versatility suggests a sophisticated protein quality control system to maintain cellular homeostasis across varying growth conditions. HtpX likely contributes through:

  • Quality control of membrane proteins involved in energy conservation during sulfidogenesis

  • Maintenance of membrane integrity during shifts between growth on different electron donors/acceptors

  • Regulation of membrane protein complexes involved in the Wood-Ljungdahl pathway

  • Potential role in stress adaptation, particularly in relation to the bacterium's ability to utilize the extensive set of sensory and regulatory proteins (>250) encoded in its genome

The bacterium's ability to grow under both heterotrophic and autotrophic conditions would require careful regulation of membrane protein composition, with proteolytic systems like HtpX playing a crucial role in this adaptation.

What is the relationship between HtpX and other proteolytic systems in bacterial membrane protein quality control?

In bacteria, multiple proteolytic systems work together to maintain protein homeostasis. Based on available information:

  • In E. coli, HtpX is suggested to work in conjunction with FtsH, an ATP-dependent membrane-bound protease, in proteolytic quality control of membrane proteins

  • In contrast to this cooperative system, some bacteria like Synechocystis have multiple Deg proteases with overlapping functions where phenotypes only emerge when all three are knocked out

  • The D. autotrophicum genome encodes various protein quality control components, though their specific interactions with HtpX remain to be characterized

How can structural analysis of D. autotrophicum HtpX advance our understanding of membrane proteases?

Structural characterization of D. autotrophicum HtpX would contribute significantly to protease research:

  • Comparison with E. coli HtpX could reveal adaptations specific to sulfate-reducing bacteria

  • Determination of the precise membrane topology would resolve controversies about the embedding of C-terminal hydrophobic regions

  • Identification of substrate-binding sites could explain substrate specificity

  • Understanding the coordination environment of the catalytic zinc ion would provide insights into the catalytic mechanism

Researchers could approach this through a combination of:

  • Cryo-electron microscopy of the membrane-embedded protein

  • X-ray crystallography of solubilized domains

  • NMR studies of specific domains

  • Computational modeling based on homologous structures

Table 1: Comparison of HtpX Characteristics in E. coli and D. autotrophicum

FeatureE. coli HtpXD. autotrophicum HtpX (predicted)
Protein familyM48 zinc metalloprotease M48 zinc metalloprotease (by homology)
Cellular locationMembrane-bound Presumed membrane-bound
Zinc dependenceRequired for activity Presumed required (by homology)
Self-degradationYes, upon cell disruption Not specifically characterized
Known substratesSecY, casein Not specifically identified
Expression systemPurified under denaturing conditions Available as His-tagged recombinant protein
In vivo assayXMS1 model substrate system Not specifically reported
Physiological roleQuality control of membrane proteins Presumed similar to E. coli homolog

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.