Recombinant Desulfobacterium autotrophicum Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
tatC; HRM2_42350; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2)
Target Names
tatC
Target Protein Sequence
MSREEEKSPFTEHLGELRDRLVRSFIAVGVGFVIAYCFKERLFDILTAPLIAAMGEGQKM IFTGLPEAFFTYLKVSLLTGVILATPVLFYEFWMFVSPGLYRKEKRFVLPVVILSIFFFC VGSSFGYFIVFPYGFQFFLGFSSDTIQAMPSMKEYLGFASKMLLAFGFVFELPLVLTFMA RMGLVSVEFLKKNRKYAILIFFTGAALITPPDVVTQIMMAIPLMILYEISIIGARVFGKK KDSDEEEAAENSDVQTDKSTDDTTPGEDQN
Uniprot No.

Target Background

Function
TatC is part of the twin-arginine translocation (Tat) system, which transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. Along with TatB, TatC forms a receptor that directly interacts with Tat signal peptides.
Database Links
Protein Families
TatC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Tat pathway and how does TatC function within it?

The twin-arginine translocation (Tat) pathway is one of two general protein transport systems found in prokaryotic cytoplasmic membranes and is conserved in plant chloroplast thylakoid membranes. Unlike the Sec pathway which transports unfolded proteins, the Tat pathway's defining characteristic is its ability to transport fully folded proteins across membranes without allowing significant ion leakage .

TatC serves as the central organizing component of the Tat pathway. It captures substrate proteins by specifically binding to their signal peptides, which contain a characteristic twin-arginine motif. After substrate binding, TatC recruits TatA family proteins to form the active translocation complex . This process enables the transport of folded proteins, which is a remarkable biophysical feat considering the need to maintain membrane integrity during translocation.

How does Desulfobacterium autotrophicum TatC differ from TatC in other bacterial species?

Desulfobacterium autotrophicum is a mesophilic sulfate-reducing bacterium that belongs to the phylum Thermodesulfobacteriota . While the core function of TatC is conserved across bacterial species, the D. autotrophicum variant may possess unique structural and functional adaptations related to its mesophilic and sulfate-reducing lifestyle.

Comparative analysis with better-studied TatC proteins, such as those from Escherichia coli and Aquifex aeolicus, reveals both conserved and variable regions. The most highly conserved regions typically correspond to functionally critical domains, including the substrate binding site and the interaction surfaces with TatA and TatB proteins . Methodologically, researchers should explore these differences through sequence alignment, homology modeling, and experimental functional assays to determine specific adaptations in the D. autotrophicum TatC.

What are the optimal conditions for recombinant expression of D. autotrophicum TatC?

Recombinant expression of membrane proteins like TatC presents significant challenges due to their hydrophobic nature and multiple transmembrane domains. For D. autotrophicum TatC, researchers should consider the following methodological approach:

  • Expression System Selection: E. coli C41(DE3) or C43(DE3) strains are often preferred for membrane protein expression as they can accommodate the toxic effects of overexpressed membrane proteins. Alternatively, cell-free expression systems may be considered for difficult-to-express variants.

  • Vector Design: Incorporating an N-terminal or C-terminal affinity tag (His6, FLAG, etc.) while ensuring the tag doesn't interfere with the protein's transmembrane topology. Based on structural data from homologous TatC proteins, the C-terminus is typically more accessible and less likely to disrupt function .

  • Induction Parameters: Optimizing expression through a Design of Experiments (DOE) approach testing various parameters:

    • Induction temperature (typically lower temperatures between 16-25°C)

    • Inducer concentration

    • Duration of expression

    • Media composition

This systematic approach allows researchers to efficiently identify optimal conditions while minimizing experimental runs, similar to approaches used in stem cell differentiation studies .

What purification strategies yield the highest purity and stability for recombinant D. autotrophicum TatC?

Purifying membrane proteins like TatC requires specialized approaches:

  • Membrane Extraction: Differential centrifugation to isolate membrane fractions, followed by solubilization using appropriate detergents. For TatC proteins, mild detergents like n-dodecyl β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin are typically effective.

  • Purification Steps:

    • Immobilized metal affinity chromatography (IMAC) for initial capture

    • Size exclusion chromatography (SEC) for removing aggregates and detergent micelles

    • Optional ion exchange chromatography for removing contaminants

  • Stability Assessment: Monitor protein stability using methods such as:

    • Thermal shift assays

    • Limited proteolysis

    • Dynamic light scattering

The purification process should be validated by SDS-PAGE, Western blotting using anti-TatC antibodies, and functional assays to confirm that the purified protein retains its native conformation and activity.

How can researchers determine the structure-function relationship of D. autotrophicum TatC?

Investigating structure-function relationships in D. autotrophicum TatC requires a multi-faceted approach:

  • Structural Analysis Methods:

    • X-ray crystallography (challenging for membrane proteins, but feasible with lipidic cubic phase crystallization)

    • Cryo-electron microscopy for larger TatC-containing complexes

    • NMR spectroscopy for specific domains or in detergent micelles

    • Homology modeling based on existing TatC structures (e.g., A. aeolicus TatC )

  • Functional Analysis:

    • Site-directed mutagenesis of key residues, particularly those in conserved regions

    • In vitro transport assays using reconstituted proteoliposomes

    • Binding assays with twin-arginine signal peptides

  • Integrative Approach:

    • Sequence co-evolution analysis to identify potentially interacting residues between TatC and other Tat components

    • Molecular dynamics simulations to investigate conformational changes

    • Crosslinking studies to validate protein-protein interactions

Conserved RegionKey ResiduesProposed FunctionExperimental Approach
Polar clusterEquivalent to E. coli Q215, T208, M205Interaction with TatA/TatBSite-directed mutagenesis, crosslinking
Cytoplasmic loopsVariesSignal peptide bindingPeptide binding assays, NMR studies
TM5/TM6 interfaceHighly conservedTatA/TatB interactionCo-evolution analysis, molecular simulations

These approaches collectively provide insights into how specific structural elements contribute to TatC function in substrate recognition and translocation.

What methods are effective for studying the interactions between D. autotrophicum TatC and other components of the Tat pathway?

Investigating protein-protein interactions involving TatC requires specialized techniques for membrane proteins:

  • Genetic Approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Suppressor mutation analysis to identify functionally linked residues

  • Biochemical Methods:

    • Co-immunoprecipitation with differentially tagged Tat components

    • Site-specific crosslinking at positions predicted by co-evolution analysis

    • Surface plasmon resonance or microscale thermophoresis for quantitative binding data

  • Structural Biology Techniques:

    • Single-particle cryo-EM of the assembled Tat complex

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Fluorescence resonance energy transfer (FRET) to detect proximity in reconstituted systems

Based on data from homologous systems, researchers should focus on:

  • The transmembrane helix of TatB, which typically interacts with two TatC molecules

  • The functionally important polar cluster at one of the TatC-TatB interfaces

  • The substrate-independent binding mode between TatA and TatC

How does substrate binding trigger the replacement of TatB by TatA at the polar cluster site in D. autotrophicum TatC?

This sophisticated question addresses a key mechanistic aspect of Tat translocase assembly. Research approaches should include:

  • Time-resolved Structural Studies:

    • Hydrogen-deuterium exchange mass spectrometry with various substrates

    • Time-resolved crosslinking experiments following substrate addition

    • Single-molecule FRET to track conformational changes in real-time

  • Computational Approaches:

    • Molecular dynamics simulations of the TatBC complex with and without bound substrate

    • Free energy calculations for TatA and TatB binding at the polar cluster site

  • Biophysical Characterization:

    • Isothermal titration calorimetry to measure binding affinities and thermodynamics

    • Binding competition assays between TatA and TatB

Current models suggest that in the resting state, TatB has higher affinity for the shared binding site on TatC, while in the substrate-activated state, TatA binding is favored . The research should focus on identifying the structural and energetic changes that drive this exchange, with particular attention to conformational changes in TatC induced by substrate binding.

How do the D. autotrophicum Tat pathway components adapt to the bacterium's mesophilic lifestyle and sulfate-reducing metabolism?

This question explores the ecological and physiological context of the Tat system in D. autotrophicum:

  • Comparative Genomic Analysis:

    • Compare Tat pathway components across sulfate-reducing bacteria and related species

    • Identify signature adaptations in the D. autotrophicum Tat machinery

  • Substrate Profiling:

    • Proteomic identification of Tat-dependent secreted proteins in D. autotrophicum

    • Functional categorization of Tat substrates related to sulfate reduction

    • Quantitative analysis of substrate specificity compared to other bacterial species

  • Environmental Adaptation Studies:

    • Temperature-dependent activity assays comparing D. autotrophicum TatC with homologs

    • pH and salt tolerance profiles of the reconstituted Tat machinery

Methodologically, researchers should employ:

  • RNA-seq to identify co-expressed genes under various growth conditions

  • Quantitative proteomics to measure abundance of Tat components

  • Biochemical assays under conditions mimicking the bacterium's natural environment

What are the optimal experimental designs for studying D. autotrophicum TatC function?

Effective experimental design is crucial for studying complex systems like the Tat pathway. Researchers should consider:

  • Design of Experiments (DOE) Approaches:

    • Fractional factorial designs for multifactorial screening of conditions

    • Response surface methodology (RSM) for optimization studies

    • Definitive screening design (DSD) for efficient parameter optimization

  • Experimental Variables to Consider:

    • Growth conditions (temperature, pH, sulfate concentration)

    • Expression parameters (induction time, media composition)

    • Buffer components (detergents, salt concentration, pH)

    • Substrate properties (size, folding state, signal peptide sequence)

  • Controls and Validations:

    • Positive controls using well-characterized Tat substrates

    • Negative controls with signal peptide mutations

    • Complementation assays in TatC-deficient strains

Implementation of statistical DOE approaches can significantly reduce experimental runs while providing robust data, similar to successful applications in stem cell differentiation processes .

How can researchers troubleshoot common issues in D. autotrophicum TatC expression and functional studies?

Researchers encountering difficulties with D. autotrophicum TatC studies may benefit from the following methodological approaches:

  • Expression Problems:

    • Low expression: Try codon optimization, lower induction temperatures, or fusion partners

    • Toxicity: Use tightly controlled expression systems or cell-free expression

    • Inclusion bodies: Test various solubilization and refolding protocols

  • Purification Challenges:

    • Poor solubilization: Screen detergent panel including newer amphipols or nanodiscs

    • Aggregation: Add stabilizing agents (glycerol, specific lipids) or screen buffer conditions

    • Low purity: Implement additional chromatography steps or optimize existing protocols

  • Functional Assay Issues:

    • No activity: Verify protein folding by circular dichroism or limited proteolysis

    • Variable results: Standardize reconstitution procedures and substrate preparation

    • Background signals: Improve negative controls and signal detection methods

IssuePossible CausesTroubleshooting Approach
Protein aggregationDetergent mismatch, improper bufferScreen detergent panel, add stabilizers
Low yieldPoor expression, losses during purificationOptimize codon usage, minimize purification steps
No functional activityMisfolding, missing cofactorsTry different reconstitution methods, add specific lipids
Inconsistent resultsVariable protein quality, unstable assayImplement stringent quality control, standardize protocols

What are the emerging techniques that could advance D. autotrophicum TatC research?

Several cutting-edge methodologies show promise for advancing our understanding of TatC structure and function:

  • Cryo-electron tomography for visualizing the Tat machinery in its native membrane environment

  • AlphaFold2 and other AI-based structure prediction tools for generating accurate structural models

  • In-cell NMR spectroscopy for studying dynamic interactions in living cells

  • Native mass spectrometry for analyzing intact membrane protein complexes

  • Microfluidics-based single-molecule techniques for real-time observation of translocation events

These approaches could address persistent questions about the exact mechanism of protein translocation, the assembly and disassembly dynamics of the Tat complex, and the energetics of the transport process.

How can comparative studies between D. autotrophicum TatC and other bacterial TatC proteins advance our understanding of the Tat pathway evolution?

Comparative evolutionary studies offer valuable insights into both conserved mechanisms and specialized adaptations:

  • Phylogenetic Analysis:

    • Construct comprehensive phylogenetic trees of TatC proteins across diverse bacteria

    • Map functional variations onto the evolutionary tree

    • Identify convergent and divergent evolutionary patterns

  • Structure-Function Comparisons:

    • Compare conserved binding sites between extremophiles, mesophiles, and other specialists

    • Identify signature sequences associated with specific environmental adaptations

    • Perform ancestral sequence reconstruction to investigate evolutionary trajectories

  • Heterologous Expression Studies:

    • Express TatC variants from different species in model organisms

    • Test cross-species compatibility between Tat components

    • Engineer chimeric proteins to identify functionally interchangeable domains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.