Recombinant Desulfococcus oleovorans ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

  • Gene Name: atpB

  • Uniprot ID: A8ZUM7

  • Protein Length: Partial (AA sequence: MEHPYLFFVKLFEALGFEHFAHTSVHIIYTWVVMALLITLGVLGARNIQIVPTKMQNFLE...)

  • Alternative Names: ATP synthase F₀ sector subunit a, F-ATPase subunit 6 .

Role in ATP Synthase

ATP synthase is a rotary enzyme composed of two sectors:

  1. F₀: Embedded in the membrane, responsible for proton translocation.

  2. F₁: Exposed to the cytoplasm, catalyzes ATP synthesis/hydrolysis.

Subunit a (atpB) interacts with the c-ring (subunit c) in the F₀ sector, forming a critical interface for proton movement . In Desulfococcus oleovorans, this process contributes to the proton motive force that drives ATP synthesis during sulfate respiration .

Recombinant Production

ParameterDetailsSource
Source OrganismDesulfococcus oleovorans strain DSM 6200/Hxd3
Expression SystemMammalian cell lines (e.g., HEK293)
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol (optimized for stability)
Shelf LifeLyophilized: 12 months at -20°C/-80°C; Liquid: 6 months at -20°C/-80°C

Handling Notes

  • Repeated freezing/thawing is discouraged.

  • Working aliquots should be stored at 4°C for ≤1 week .

Functional Studies

  1. Proton Translocation Assays:
    Subunit a is used to investigate proton movement kinetics and the role of conserved residues (e.g., Arg 210) in Desulfococcus oleovorans .

  2. Structural Elucidation:
    Recombinant subunit a aids in crystallography or cryo-EM studies to resolve F₀-F₁ interactions, particularly in sulfate-reducing bacteria (SRB) .

Immunoassays

  • ELISA Development: The recombinant protein serves as an antigen for generating antibodies specific to ATP synthase subunit a, enabling detection in D. oleovorans or related SRB .

Metabolic Context in SRB

In D. oleovorans, ATP synthase operates in tandem with electron transfer complexes like QmoABC, which channel electrons to APS reductase during sulfate respiration . The proton gradient generated by these systems drives ATP synthesis via subunit a .

Subunit a Across Bacterial Lineages

OrganismSubunit a FeaturesKey ResiduesSource
E. coliArg 210 (proton release), Glu 196/219 (proton binding)Arg 210, Glu 196, Glu 219
Bacillus PS3Conserved helical structure; interacts with c-ring (10 subunits)Arg 169 (equivalent to E. coli Arg 210)
Desulfococcus oleovoransAlkane-carboxylating strain Hxd3; ATP synthase adapted for sulfate respirationArg 169 (predicted)

References

  1. Product Specifications: Cusabio , E-Scape Bio .

  2. Structural Biology: eLife .

  3. Genomic Context: Wikipedia .

  4. Metabolic Pathways: ASM Journals .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet customer specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type if you have any preferences; we will prioritize its development.
Synonyms
atpB; Dole_0630; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Desulfococcus oleovorans (strain DSM 6200 / Hxd3)
Target Names
atpB
Target Protein Sequence
MEHPYLFFVKLFEALGFEHFAHTSVHIIYTWVVMALLITLGVLGARNIQIVPTKMQNFLE VLISGIEEFMVSVTGEEGRWFFPLAGTIAIFIAVSNLIGLVPGFFPPTASINTPLACAIV VFVFTHFIGIKYHGPKYIKHFLGPVWWLAPLIFPIEIIGHLARVLSLTFRLFGNMMGHES VLVILFMLGGAFFAPLPIMALGIFVAFVQAFVFFLLSVMYFAGAMEHAH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary origin of ATP synthase subunit a (atpB) in Desulfococcus oleovorans?

The ATP synthase subunit a (atpB) in Desulfococcus oleovorans (classified as De_oleHe in genomic studies) appears to have been acquired through horizontal gene transfer (HGT) from Thermotogae bacteria . This makes it particularly interesting for evolutionary studies of ATP synthase complexes. The evidence for this horizontal gene transfer is found in phylogenetic analyses that show atpB sequences from D. oleovorans clustering with Thermotogae sequences rather than with those from closely related delta-proteobacteria . This unusual evolutionary history contributes to the unique properties of the D. oleovorans ATP synthase complex and represents an important case study in the evolution of bioenergetic systems through horizontal gene transfer.

What is the structural organization of ATP synthase genes in D. oleovorans?

Desulfococcus oleovorans exhibits an unusual "double OA-OC-OB′-OB" gene arrangement for its ATP synthase components . This organization differs from the typical ATP synthase operon structure seen in most bacteria. Specifically, D. oleovorans contains duplicated genes for the F0 sector subunits (a, c, and b), with horizontal gene transfer potentially explaining the origin of some of these duplicated components . This unusual genetic arrangement raises interesting questions about the assembly and function of the complete ATP synthase complex in this organism. Researchers investigating this system should consider the implications of this gene arrangement for protein expression, complex assembly, and functional studies.

How does D. oleovorans ATP synthase compare structurally to well-characterized ATP synthases?

While the specific structure of D. oleovorans ATP synthase has not been determined at high resolution, we can draw comparisons with other bacterial F-type ATP synthases. The basic F1F0 ATP synthase structure consists of a membrane-embedded F0 sector (including subunit a) and a catalytic F1 sector. The ATP synthase in D. oleovorans likely follows this general architecture but with potential modifications resulting from its unusual evolutionary history . For context, the F1-ATPase from Acinetobacter baumannii has been structurally characterized at 3.0 Å resolution, revealing a complex with subunits α3:β3:γ:ε . Detailed structural studies specific to D. oleovorans ATP synthase would be required to identify unique features resulting from its horizontally acquired components.

What are the consequences of horizontal gene transfer on ATP synthase function in D. oleovorans?

The horizontal gene transfer of ATP synthase components in D. oleovorans from Thermotogae raises fundamental questions about functional adaptation . Thermotogae bacteria typically thrive in high-temperature environments, while D. oleovorans occupies moderate-temperature, anaerobic, sulfate-rich niches. This evolutionary transition would require significant adaptations in protein structure and function. Research approaches to address this question include comparative biochemical analyses of the ATP synthase from both organisms, site-directed mutagenesis to identify adaptive mutations, and functional assays under varying temperature and pH conditions. The functional integration of horizontally acquired components into the existing bioenergetic machinery represents a fascinating area for investigation in this system.

How might the duplicated ATP synthase subunits in D. oleovorans contribute to its bioenergetic flexibility?

The presence of duplicated ATP synthase components (double OA-OC-OB′-OB) in D. oleovorans suggests potential functional specialization or redundancy . This gene arrangement might enable the organism to assemble different ATP synthase variants optimized for specific environmental conditions. Methodological approaches to investigate this include targeted gene deletions to create strains expressing only specific subunit variants, followed by growth and bioenergetic analyses under different conditions. Proteomic approaches could also determine which variants are expressed under different growth conditions. This aspect of ATP synthase diversity may contribute to the metabolic versatility of D. oleovorans in its environment.

What is the relationship between ATP synthase function and the sulfate-reducing lifestyle of D. oleovorans?

As a sulfate-reducing bacterium, D. oleovorans has specific bioenergetic requirements that may be reflected in its ATP synthase characteristics. The sulfate reduction pathway generates a proton motive force that drives ATP synthesis. Investigating how the potentially Thermotogae-derived ATP synthase components have adapted to function with this electron transport chain would provide valuable insights into bioenergetic system integration. Methods to explore this include comparative studies with other sulfate-reducing bacteria that possess conventional ATP synthases, membrane potential measurements, and ATP synthesis assays under varying sulfate concentrations and redox conditions.

What expression systems are optimal for producing recombinant D. oleovorans atpB?

Expressing recombinant membrane proteins like ATP synthase subunit a presents significant challenges. For D. oleovorans atpB, several expression systems merit consideration:

  • E. coli-based systems: Despite being the standard for recombinant protein expression, E. coli may not be optimal for D. oleovorans atpB due to differences in membrane composition and protein processing. If using E. coli, consider strain C41(DE3) or C43(DE3), which are engineered for membrane protein expression.

  • Homologous expression: Expression in closely related delta-proteobacteria may provide a more native environment for proper folding and insertion.

  • Cell-free expression systems: These can be valuable for toxic membrane proteins and allow direct incorporation into liposomes.

When designing expression constructs, researchers should include appropriate affinity tags that minimally interfere with protein folding and function. Codon optimization may be necessary when expressing in phylogenetically distant hosts. Expression trials should test multiple induction conditions, including temperature, inducer concentration, and duration to optimize protein yield and quality.

What purification strategies yield functional recombinant D. oleovorans atpB?

Purification of recombinant atpB requires careful consideration of its membrane protein nature:

  • Membrane preparation: After cell lysis, differential centrifugation isolates membrane fractions.

  • Detergent solubilization: Test multiple detergents (DDM, LMNG, digitonin) at various concentrations to identify conditions that effectively solubilize atpB without denaturation.

  • Affinity chromatography: Using engineered affinity tags for initial purification.

  • Size exclusion chromatography: For final purification and assessment of protein homogeneity.

Throughout purification, maintain conditions that preserve protein stability, which may include specific lipids, salt concentrations, and pH ranges. Similar approaches have been successfully employed for the purification of A. baumannii F1-ATPase, which required specific conditions to maintain its latent ATP hydrolysis state .

How can researchers assess the functionality of recombinant D. oleovorans ATP synthase?

Several complementary approaches can verify the functionality of recombinant ATP synthase components:

  • ATP hydrolysis assays: Measure ATPase activity using colorimetric phosphate release assays with appropriate controls for background activity.

  • ATP synthesis assays: Using inverted membrane vesicles or reconstituted proteoliposomes with an artificially induced proton gradient.

  • Proton translocation assays: Using pH-sensitive fluorescent dyes to monitor proton movement across membranes.

  • Binding studies: Examine interactions between atpB and other ATP synthase subunits using techniques like co-immunoprecipitation or surface plasmon resonance.

These functional assays should be performed under various conditions to identify the optimal environment for D. oleovorans ATP synthase activity, particularly considering its potential adaptation from a thermophilic to mesophilic lifestyle .

What structural techniques are most appropriate for characterizing D. oleovorans atpB?

Several structural biology approaches could be employed to characterize D. oleovorans atpB:

  • Cryo-electron microscopy (cryo-EM): This technique has been successfully used to determine the structure of ATP synthase complexes, as demonstrated by the 3.0 Å structure of A. baumannii F1-ATPase . Cryo-EM is particularly valuable for membrane protein complexes and can reveal the architecture of the entire ATP synthase.

  • X-ray crystallography: While challenging for membrane proteins, this approach can provide high-resolution structural data if suitable crystals can be obtained.

  • NMR spectroscopy: Solution NMR has been used to determine the structure of ATP synthase subunits, such as the compact form of the ε subunit in A. baumannii . This technique could provide insights into domain interactions and dynamics.

  • Hydrogen-deuterium exchange mass spectrometry: This method can provide information about protein dynamics and solvent accessibility without requiring crystallization.

Each technique has strengths and limitations, and a multi-technique approach often provides the most comprehensive structural information.

How might D. oleovorans ATP synthase function under different pH conditions?

Recent research on yeast ATP synthase has revealed important insights into how these enzymes function under acidic conditions. Under low pH, ATP synthase can adopt multiple conformational states, including unique intermediates not observed under neutral conditions . Given that D. oleovorans inhabits environments that may experience pH fluctuations, its ATP synthase might exhibit similar conformational plasticity.

Methodologically, researchers could investigate this by:

  • pH-dependent activity assays: Measuring ATP hydrolysis and synthesis rates across a range of pH values.

  • Structural studies at various pH levels: Similar to the approach taken with yeast ATP synthase, structural analyses under different pH conditions could reveal conformational changes .

  • Site-directed mutagenesis: Targeting residues likely involved in pH sensing or conformational changes to determine their roles in pH-dependent regulation.

This research direction is particularly relevant given the growing interest in how ATP synthases function under various physiological and pathological conditions, including hypoxia-induced acidosis .

What can comparative genomics reveal about the evolutionary history of ATP synthase in Desulfococcus and related genera?

Comparative genomics approaches can provide significant insights into the unusual evolutionary history of ATP synthase in D. oleovorans:

  • Phylogenetic analyses: Constructing phylogenetic trees based on ATP synthase subunit sequences across diverse bacterial lineages can confirm and better characterize the proposed horizontal gene transfer from Thermotogae .

  • Synteny analysis: Examining the genomic context of ATP synthase genes can reveal evolutionary events such as gene duplications, rearrangements, and horizontal transfers.

  • Selection analysis: Computing dN/dS ratios and other selection metrics can identify regions of the protein under purifying or positive selection, providing clues about functional adaptation.

  • Ancestral sequence reconstruction: This approach can model the evolutionary trajectory of ATP synthase components after horizontal transfer.

The Table 2 from the research literature provides a valuable starting point, showing the distribution of gene duplications across different lineages and highlighting the unique pattern in D. oleovorans with potential horizontal gene transfer from Thermotogae .

How might the study of D. oleovorans atpB contribute to our understanding of ATP synthase evolution?

The unusual evolutionary history of D. oleovorans atpB offers a natural experiment in protein adaptation after horizontal gene transfer. This system can address several fundamental evolutionary questions:

  • Functional adaptation: How does a protein evolved in one bacterial lineage (Thermotogae) adapt to function in a dramatically different host (delta-proteobacteria)?

  • Co-evolution: How do horizontally acquired components co-evolve with native components to maintain a functional complex?

  • Selective advantages: What selective advantages might have driven the acquisition and retention of foreign ATP synthase components?

  • Modular evolution: Does this case support the concept of modular evolution in multi-subunit complexes?

Research in this area connects to broader questions about the evolution of bioenergetic systems and the role of horizontal gene transfer in bacterial adaptation to specific ecological niches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.