Recombinant Desulfococcus oleovorans UPF0059 membrane protein Dole_1531 (Dole_1531)

What is the basic structure and composition of Recombinant Desulfococcus oleovorans UPF0059 membrane protein Dole_1531?

Recombinant Desulfococcus oleovorans UPF0059 membrane protein Dole_1531 is a full-length protein (189 amino acids) that functions as a putative manganese efflux pump (MntP). The recombinant form is expressed in E. coli with an N-terminal His tag. The amino acid sequence is: MNTLTIFGIAVALAMDAFAVSIAAGVFLRSIGLRHYFRLAWHFGLFQALMPIVGWYAGLSVRGLIERYDHWIAFFLLAFVSFNMIRESFDAGENHTKADPTRGLRLVLLSIATSIDALAVGLSLSVLNVSVWMPATVIGITAAVFTVGGLMMGSRAGDIPWLRRYADRVGAGVLLFIGLRILYAHGVFY . As a membrane protein, it contains hydrophobic regions that integrate into the lipid bilayer, which is critical for its function as a transporter.

What are the optimal storage conditions for Recombinant Dole_1531 protein to maintain stability?

The recombinant Dole_1531 protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. For working aliquots, store at 4°C for up to one week. The protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) after reconstituting the lyophilized powder in deionized sterile water to a concentration of 0.1-1.0 mg/mL . This glycerol addition helps prevent protein degradation during freeze-thaw cycles.

How does the amino acid sequence of Dole_1531 compare to similar proteins from other bacterial species?

The UPF0059 membrane protein family shows sequence conservation across different bacterial species, with variations that may reflect evolutionary adaptations to different environments. Below is a comparative analysis of Dole_1531 and the similar BVU_2631 protein from Bacteroides vulgatus:

Both proteins belong to the same functional family (manganese efflux pumps) despite originating from different bacterial species, suggesting conserved functional domains important for manganese transport . The sequence variations likely reflect adaptations to the different environmental niches of these bacteria.

What is the recommended reconstitution protocol for lyophilized Dole_1531 protein to ensure optimal activity?

For optimal reconstitution of lyophilized Dole_1531 protein, follow this methodological approach:

• Centrifuge the vial briefly before opening to bring contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended as default)

• Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

• Store aliquots at -20°C/-80°C for long-term storage

When preparing working solutions, allow aliquots to equilibrate to room temperature before opening to prevent condensation, which can affect protein stability. For functional studies, consider buffer optimization experiments, as membrane proteins often require specific conditions to maintain native conformation and activity. If activity loss is observed, check pH stability and consider adding cofactors that might be required for proper folding and function of this manganese transporter.

What methods are most effective for assessing the purity and integrity of Recombinant Dole_1531 protein?

The most effective methods for assessing purity and integrity of Recombinant Dole_1531 protein include:

• SDS-PAGE Analysis: The primary method for purity assessment, with expected purity greater than 90% . Run samples alongside molecular weight markers to confirm the expected size (~21 kDa plus the His-tag).

• Western Blotting: Using anti-His antibodies to detect the N-terminal His tag, confirming both identity and integrity.

• Size Exclusion Chromatography (SEC): To assess aggregation state and homogeneity.

• Mass Spectrometry: For precise molecular weight determination and verification of post-translational modifications.

• Circular Dichroism (CD): To evaluate secondary structure, especially important for membrane proteins to confirm proper folding.

For membrane proteins like Dole_1531, additional specialized techniques may be valuable:

• Blue Native PAGE: To assess oligomeric state in near-native conditions.

• Dynamic Light Scattering (DLS): To evaluate size distribution and potential aggregation.

Quality control should include periodic stability assessments, especially when working with aliquots stored for extended periods.

How can researchers effectively solubilize and maintain the stability of Dole_1531 membrane protein for functional studies?

Membrane proteins like Dole_1531 require specialized solubilization approaches for functional studies:

• Detergent Selection:

  • Start with mild non-ionic detergents (DDM, LMNG, or OG)

  • Screen multiple detergents at various concentrations above their CMC

  • Consider using fluorinated detergents for increased stability

• Buffer Optimization:

  • Maintain pH 7.0-8.0 (Tris-based buffers are provided in the commercial product)

  • Include stabilizing agents like glycerol (5-20%)

  • Add specific lipids (POPC, POPE) to maintain native-like environment

• Temperature Control:

  • Perform manipulations at 4°C when possible

  • Avoid repeated freeze-thaw cycles

• Alternative Approaches:

  • Nanodiscs or SMALPs for a more native-like membrane environment

  • Reconstitution into proteoliposomes for transport assays

• Stability Assessment Protocol:

  • Monitor protein stability via SEC or DLS over time

  • Use thermostability assays (DSF/CPM) to optimize conditions

For functional characterization as a manganese transporter, consider reconstitution into proteoliposomes with established manganese detection methods (fluorescent indicators or ICP-MS) to measure transport activity under various conditions.

What experimental design would be most appropriate for investigating the manganese transport kinetics of Dole_1531 in a reconstituted system?

To investigate manganese transport kinetics of Dole_1531, I recommend the following comprehensive experimental design:

• Proteoliposome Preparation:

  • Reconstitute purified Dole_1531 into liposomes composed of E. coli polar lipids or defined lipid mixtures

  • Use protein-to-lipid ratios of 1:100, 1:200, and 1:500 (w/w) to determine optimal density

  • Confirm successful reconstitution via freeze-fracture electron microscopy and protease protection assays

• Transport Assay Setup:

  • Develop a real-time fluorescence-based assay using manganese-sensitive probes (e.g., CalciumGreen-5N)

  • Alternatively, establish a radioactive 54Mn2+ uptake/efflux assay

  • Include liposomes without protein as negative controls

  • Use known manganese transporters (if available) as positive controls

• Kinetic Measurements:

  • Determine transport rates at varying Mn2+ concentrations (0.1-1000 μM)

  • Calculate Km and Vmax parameters

  • Perform assays at different pH values (6.5-8.0) and temperatures (25-37°C)

  • Investigate potential inhibitors and competing metal ions

• Data Analysis:

  • Fit initial transport rates to Michaelis-Menten kinetics

  • Apply appropriate corrections for non-specific binding

  • Use Lineweaver-Burk and Eadie-Hofstee plots to identify potential transport mechanisms

• Comparative Analysis:

  • Compare transport kinetics between Dole_1531 and BVU_2631 to identify species-specific adaptations

  • Correlate transport efficiency with the organism's natural environment and manganese requirements

This experimental design addresses the fundamental mechanisms of manganese transport while providing insights into the physiological role of Dole_1531 in Desulfococcus oleovorans.

What strategies can be employed to investigate the structure-function relationship of Dole_1531, particularly regarding the identification of key residues involved in manganese transport?

To elucidate the structure-function relationship of Dole_1531, implement this comprehensive strategy:

• Sequence-Based Analysis:

  • Perform multiple sequence alignment with homologous manganese transporters

  • Identify conserved motifs and residues across the UPF0059 family

  • Generate hydropathy plots to predict transmembrane regions

  • Use evolutionary coupling analysis to identify co-evolving residues

• Site-Directed Mutagenesis Approach:

  • Target conserved residues, particularly those with charged or polar side chains

  • Create systematic alanine scanning mutations of transmembrane domains

  • Focus on regions rich in histidine, aspartate, and glutamate residues (common metal coordination sites)

  • Generate single, double, and compensatory mutations to test functional hypotheses

• Functional Characterization of Mutants:

  • Measure manganese transport activity in reconstituted systems

  • Determine binding affinities for Mn2+ and other divalent cations

  • Assess protein stability changes resulting from mutations

  • Investigate pH dependency alterations in mutant proteins

• Structural Biology Techniques:

  • Attempt crystallization trials for X-ray crystallography

  • Consider cryo-EM for structural determination

  • Apply HDX-MS to identify regions with altered solvent accessibility upon substrate binding

  • Use DEER spectroscopy to measure conformational changes during transport

• Computational Approaches:

  • Develop homology models based on related transporters

  • Perform molecular dynamics simulations of wild-type and mutant proteins

  • Use computational docking to predict manganese binding sites

  • Simulate ion permeation pathways through the protein

This multidisciplinary approach will provide complementary insights into how specific structural elements of Dole_1531 contribute to its function as a manganese efflux pump.

How can researchers design experiments to elucidate the physiological role and regulation of Dole_1531 within Desulfococcus oleovorans?

To elucidate the physiological role and regulation of Dole_1531 in Desulfococcus oleovorans, implement this comprehensive experimental design strategy:

• Gene Expression Analysis:

  • Cultivate D. oleovorans under various manganese concentrations (0.1-1000 μM)

  • Monitor mntP gene expression levels using RT-qPCR

  • Perform RNA-Seq to identify co-regulated genes

  • Map the transcriptional start site using 5' RACE

  • Identify potential regulatory elements in the promoter region

• Gene Disruption Studies:

  • Generate mntP knockout strains using CRISPR-Cas or homologous recombination

  • Create conditional expression systems if the gene is essential

  • Develop complementation strains with wild-type and mutant mntP alleles

  • Measure growth rates under varying manganese concentrations

• Phenotypic Characterization:

  • Determine intracellular manganese levels using ICP-MS

  • Assess sensitivity to manganese and other metal stressors

  • Measure activities of manganese-dependent enzymes

  • Evaluate biofilm formation and other physiological parameters

• Protein-Protein Interaction Studies:

  • Identify interaction partners using co-immunoprecipitation

  • Perform bacterial two-hybrid assays to validate interactions

  • Map protein complexes using crosslinking mass spectrometry

  • Investigate the role of potential regulatory proteins

• Environmental Response Analysis:

  • Examine Dole_1531 regulation under various stress conditions

  • Test effects of oxygen levels, pH changes, and nutrient limitations

  • Investigate regulation in relation to the anaerobic lifestyle of D. oleovorans

  • Compare responses to those of related sulfate-reducing bacteria

This systematic approach will provide comprehensive insights into how Dole_1531 functions within the broader physiological context of Desulfococcus oleovorans, particularly regarding manganese homeostasis and stress responses.

How does Dole_1531 compare structurally and functionally to other characterized manganese transporters from different bacterial species?

Dole_1531 belongs to the UPF0059 family of membrane proteins that function as putative manganese efflux pumps (MntP). When compared to other bacterial manganese transporters, several important distinctions emerge:

Structurally, Dole_1531 likely adopts a multi-pass transmembrane configuration typical of the UPF0059 family. Unlike the larger and more complex ABC transporters (MntABC) that require ATP hydrolysis, Dole_1531 likely functions through secondary active transport mechanisms. The presence of similar transporters across diverse bacterial phyla suggests that manganese efflux is a conserved and essential process for bacterial metal homeostasis.

Functionally, while most characterized manganese transporters in various bacteria facilitate uptake (MntH, MntABC), Dole_1531 and other MntP homologs appear specialized for manganese efflux, offering protection against manganese toxicity. This functional specialization is particularly relevant for Desulfococcus oleovorans, an anaerobic sulfate-reducing bacterium that may encounter varying metal concentrations in its environmental niche.

What experimental approaches would be most effective for comparing the metal selectivity of Dole_1531 with other UPF0059 family proteins?

To effectively compare the metal selectivity of Dole_1531 with other UPF0059 family proteins, I recommend this comprehensive experimental strategy:

• Parallel Protein Expression and Purification:

  • Express and purify Dole_1531, BVU_2631, and E. coli MntP under identical conditions

  • Confirm comparable purity (>90%) using SDS-PAGE

  • Verify protein identity via mass spectrometry and N-terminal sequencing

  • Reconstitute all proteins using the same lipid composition and protein-to-lipid ratio

• Direct Metal Binding Assays:

  • Measure binding affinities for various metals (Mn²⁺, Fe²⁺, Zn²⁺, Cu²⁺, Ni²⁺, Co²⁺, Cd²⁺)

  • Employ isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Use microscale thermophoresis (MST) as a complementary approach

  • Perform competition binding assays between different metals

• Transport Activity Measurements:

  • Develop fluorescence-based real-time assays for each metal ion

  • Conduct radioactive metal uptake/efflux assays in proteoliposomes

  • Measure transport kinetics (Km, Vmax) for each metal

  • Determine the effect of competing metals on manganese transport

• Protein Stability Studies:

  • Assess thermal stability using differential scanning fluorimetry (DSF)

  • Measure stability in the presence of different metal ions

  • Identify metal-induced conformational changes via tryptophan fluorescence

  • Determine metal-dependent oligomerization states using SEC-MALS

• Comparative Analysis Framework:

  • Create selectivity profiles based on binding affinity ratios

  • Generate radar plots showing relative transport efficiency for each metal

  • Apply principal component analysis to identify patterns in metal selectivity

  • Correlate selectivity profiles with the native environment of each bacterial species

This methodical approach will systematically identify differences in metal selectivity between these related transporters while providing mechanistic insights into how structural variations influence substrate preference.

What are the challenges and potential solutions in adapting Dole_1531 expression systems for structural biology studies compared to other membrane proteins?

Membrane protein structural biology presents significant challenges, particularly for proteins like Dole_1531. Here are the key challenges and methodological solutions specific to this protein:

• Expression Yield Challenges:

  • Challenge: Membrane protein overexpression often leads to toxicity and inclusion body formation

  • Solutions:

    • Utilize specialized E. coli strains (C41/C43, Lemo21) designed for membrane protein expression

    • Explore codon-optimized constructs for Dole_1531

    • Test inducible promoters with tight regulation (pBAD, pRha)

    • Consider cell-free expression systems

• Protein Extraction and Purification:

  • Challenge: Efficient extraction from membranes without denaturation

  • Solutions:

    • Screen detergent panels beyond standard options

    • Implement GFP-fusion approaches for rapid optimization

    • Test styrene-maleic acid copolymer (SMA) extraction

    • Develop optimized two-step purification leveraging the His-tag

• Structural Stability:

  • Challenge: Maintaining native-like conformation outside the membrane

  • Solutions:

    • Implement high-throughput stability assays (DSF, CPM)

    • Explore lipid-like detergents (MNG, GDN)

    • Add specific lipids identified in D. oleovorans membranes

    • Test nanodiscs with varying scaffold proteins

• Crystallization Barriers:

  • Challenge: Obtaining well-diffracting crystals

  • Solutions:

    • Apply lipidic cubic phase (LCP) crystallization

    • Generate thermostabilized variants via systematic mutagenesis

    • Create fusion constructs with crystallization chaperones

    • Test antibody-fragment co-crystallization

• Cryo-EM Considerations:

  • Challenge: Small size (~21 kDa) makes Dole_1531 suboptimal for cryo-EM

  • Solutions:

    • Generate oligomeric constructs

    • Add megabody or nanobody binders to increase particle size

    • Use Volta phase plates to enhance contrast

    • Explore scaffold-based approaches to increase effective size

• Comparative Advantages:

  • Dole_1531's relatively small size (189 aa) compared to many transporters makes it potentially amenable to NMR studies

  • The availability of homologous proteins like BVU_2631 enables parallel structural efforts to increase success probability

This systematic approach addresses the specific challenges of Dole_1531 structural biology while leveraging its unique properties and available resources.

What are the most common challenges encountered when working with recombinant Dole_1531 protein, and what troubleshooting strategies can address them?

Researchers commonly encounter several challenges when working with recombinant Dole_1531 protein. This comprehensive troubleshooting guide addresses these issues with methodological solutions:

• Low Expression Yield:

  • Problem: Poor production of recombinant Dole_1531 in E. coli

  • Diagnostic Signs: Weak bands on SDS-PAGE, low protein concentration after purification

  • Solutions:

    • Optimize induction conditions (temperature: try 18°C, 25°C, 30°C; IPTG concentration: 0.1-1.0 mM)

    • Test different E. coli strains (BL21(DE3), C41(DE3), Rosetta)

    • Consider codon optimization for the D. oleovorans sequence

    • Evaluate auto-induction media formulations

• Protein Aggregation:

  • Problem: Formation of inclusion bodies or aggregation during purification

  • Diagnostic Signs: Protein in pellet after centrifugation, elution in void volume on SEC

  • Solutions:

    • Reduce expression temperature to 16-18°C

    • Add stabilizing agents (glycerol, specific lipids, mild detergents)

    • Optimize buffer conditions (pH 7.0-8.0, salt concentration 150-300 mM)

    • Consider refolding protocols if expression in inclusion bodies is unavoidable

• Proteolytic Degradation:

  • Problem: Protein degradation during expression or purification

  • Diagnostic Signs: Multiple lower molecular weight bands on SDS-PAGE

  • Solutions:

    • Add protease inhibitors throughout purification

    • Reduce purification time and maintain samples at 4°C

    • Add EDTA (1-5 mM) if metal-dependent proteases are suspected

    • Consider N- and C-terminal construct optimization to remove protease-sensitive regions

• Low Purity:

  • Problem: Contaminants persist after His-tag purification

  • Diagnostic Signs: Multiple bands on SDS-PAGE despite purification

  • Solutions:

    • Implement two-step purification (IMAC followed by SEC or ion exchange)

    • Optimize imidazole washing steps (try 20-50 mM imidazole washes)

    • Consider detergent washing to remove associated membrane proteins

    • Test different matrix materials for His-tag purification

• Activity Loss During Storage:

  • Problem: Loss of functional activity over time

  • Diagnostic Signs: Decreased transport activity in functional assays

  • Solutions:

    • Store protein with 5-50% glycerol as recommended

    • Aliquot and flash-freeze to avoid freeze-thaw cycles

    • Store at -80°C rather than -20°C for long-term storage

    • Consider lyophilization with appropriate cryoprotectants

This systematic troubleshooting approach addresses the specific challenges associated with Dole_1531, enabling researchers to optimize their experimental procedures and obtain reliable results.

How can researchers optimize assay conditions to accurately measure the manganese transport activity of Dole_1531?

To accurately measure the manganese transport activity of Dole_1531, researchers should implement this comprehensive assay optimization strategy:

• Reconstitution Optimization:

  • Buffer Composition:

    • Test pH range (6.5-8.0) in 0.5 unit increments

    • Evaluate different buffers (HEPES, MOPS, Tris) at 20-50 mM

    • Optimize ionic strength (100-300 mM NaCl or KCl)

    • Screen divalent cation concentrations (0-5 mM MgCl₂)

  • Lipid Composition:

    • Compare E. coli polar lipids vs. defined mixtures (POPC:POPE:POPG)

    • Test cholesterol incorporation (0-20%)

    • Evaluate the effect of cardiolipin addition (0-10%)

    • Optimize protein-to-lipid ratios (1:100 to 1:1000)

• Transport Assay Development:

  • Direct Measurement Methods:

    • ICP-MS or atomic absorption for direct manganese quantification

    • Radioactive ⁵⁴Mn²⁺ flux measurements

    • Fluorescent indicator-based assays (Calcium Green-5N displacement)

  • Indirect Assessment Approaches:

    • pH-sensitive dyes if transport is proton-coupled

    • Membrane potential indicators if electrogenic

    • Enzyme-coupled assays for ATP consumption if energy-dependent

• Kinetic Parameter Determination:

  • Concentration Range Optimization:

    • Establish broad Mn²⁺ concentration range (0.1-1000 μM)

    • Perform detailed measurements around predicted Km

    • Control free Mn²⁺ using appropriate buffers/chelators

  • Time Course Optimization:

    • Determine linear range of transport activity

    • Establish optimal sampling times (typically 15s, 30s, 1min, 2min, 5min)

    • Develop stopped-flow approaches for rapid kinetics

• Control Experiments:

  • Negative Controls:

    • Proteoliposomes without protein

    • Heat-inactivated protein preparations

    • Non-functional mutants (if available)

  • Positive Controls:

    • Known manganese transporters (if available)

    • Ionophores with manganese permeability

• Data Analysis Framework:

  • Apply Michaelis-Menten kinetics corrections

  • Account for non-specific binding

  • Develop appropriate normalization strategies

  • Establish statistical validation criteria

This systematic optimization approach will enable researchers to establish robust and reproducible assays for accurately measuring the manganese transport activity of Dole_1531, facilitating meaningful comparisons across experimental conditions and between different transporter variants.

What strategies can be employed to improve the solubility and stability of Dole_1531 for long-term functional and structural studies?

Improving the solubility and stability of membrane proteins like Dole_1531 requires a systematic approach targeting multiple aspects of protein handling. Here is a comprehensive strategy:

• Construct Engineering:

  • Terminal Modifications:

    • Test various N-terminal tag positions and linker lengths

    • Consider dual tagging (N-terminal His and C-terminal FLAG/Strep)

    • Evaluate tag removal options (TEV/PreScission protease sites)

  • Sequence Optimization:

    • Identify and mutate surface-exposed hydrophobic residues

    • Apply computational stability prediction algorithms

    • Create fusion constructs with solubility-enhancing partners (MBP, SUMO)

    • Remove flexible regions identified by limited proteolysis

• Expression Conditions:

  • Growth Parameters:

    • Lower induction temperature (16-18°C)

    • Reduce inducer concentration

    • Extend expression time (24-48h)

  • Media Formulation:

    • Test minimal media vs. rich media

    • Add specific osmolytes (betaine, glycine, sucrose)

    • Supplement with specific lipids or cholesterol precursors

• Advanced Solubilization Strategies:

  • Detergent Screening:

    • Systematic testing of detergent classes (nonionic, zwitterionic, amphipols)

    • Evaluate newer detergents (MNG, GDN, LMNG)

    • Test mixed micelles (detergent combinations)

  • Alternative Systems:

    • Styrene maleic acid lipid particles (SMALPs)

    • Nanodiscs with optimized scaffold proteins

    • Peptidisc or saposin-based systems

    • Detergent-free extraction using native nanodiscs

• Buffer Optimization:

  • Stabilizing Additives:

    • Glycerol (5-20%)

    • Specific lipids (cholesterol, cardiolipin)

    • Osmolytes (sucrose, trehalose)

    • Arginine and glutamate combinations

  • pH and Ionic Conditions:

    • Fine-tune pH based on stability profiles (typically 7.0-8.0)

    • Optimize salt type and concentration

    • Test different buffering agents

• Long-term Storage Solutions:

  • Cryopreservation:

    • Flash-freezing in liquid nitrogen

    • Controlled-rate freezing protocols

    • Addition of cryoprotectants beyond glycerol

  • Lyophilization:

    • Develop specialized lyophilization protocols

    • Test various lyoprotectants

    • Establish reconstitution procedures post-lyophilization

• Stability Assessment Methods:

  • Implement thermal shift assays (DSF/nanoDSF)

  • Use SEC-MALS for aggregation monitoring

  • Apply hydrogen-deuterium exchange mass spectrometry

  • Develop activity-based stability assays

This comprehensive approach addresses multiple aspects of protein stability, providing researchers with systematic strategies to improve the solubility and long-term stability of Dole_1531 for both functional and structural studies.

What are the most promising research directions for understanding the physiological role of Dole_1531 in metal homeostasis?

Understanding the physiological role of Dole_1531 in metal homeostasis represents a significant research opportunity. These promising research directions could yield substantial insights:

• Integrated Omics Approach:

  • Transcriptomic Analysis:

    • RNA-Seq under varying manganese concentrations

    • Identification of co-regulated genes in the Dole_1531 regulon

    • Temporal expression patterns during environmental transitions

  • Proteomic Profiling:

    • Quantitative proteomics comparing wild-type and Dole_1531 mutants

    • Identification of protein-protein interaction networks

    • Post-translational modifications affecting transport activity

  • Metallomics:

    • Comprehensive metal profiling using ICP-MS

    • Subcellular metal distribution patterns

    • Metal flux analysis using stable isotopes

• Systems Biology of Metal Homeostasis:

  • Regulatory Network Mapping:

    • Identification of transcription factors controlling Dole_1531 expression

    • ChIP-Seq to map global regulatory interactions

    • Construction of mathematical models of manganese homeostasis

  • Metabolic Integration:

    • Metabolomic analysis of manganese-dependent pathways

    • Flux balance analysis incorporating metal cofactor requirements

    • Investigation of energy coupling in transport processes

• Ecological and Evolutionary Context:

  • Comparative Genomics:

    • Analysis of Dole_1531 conservation across sulfate-reducing bacteria

    • Identification of genomic contexts and operonic structures

    • Detection of horizontal gene transfer events

  • Environmental Adaptation:

    • Metal tolerance profiles in different environmental isolates

    • Correlation between habitat metal content and transporter properties

    • Experimental evolution under manganese-stress conditions

• Structural-Functional Integration:

  • Transport Mechanism Elucidation:

    • Determination of ion coupling mechanisms (H⁺, Na⁺)

    • Identification of metal coordination sites

    • Characterization of conformational changes during transport

  • Regulatory Interactions:

    • Metal-sensing mechanisms affecting transporter activity

    • Allosteric regulation by other cellular components

    • Post-translational modifications impacting function

• Biotechnological Applications:

  • Bioremediation Potential:

    • Engineering enhanced metal efflux systems for contaminated environments

    • Development of whole-cell biosensors for manganese detection

    • Manipulation of metal tolerance in industrial microorganisms

This research framework provides multiple complementary approaches to understanding how Dole_1531 contributes to metal homeostasis in Desulfococcus oleovorans, with implications extending to bacterial physiology, environmental adaptation, and biotechnology applications.

How might advanced structural biology techniques be applied to elucidate the transport mechanism of Dole_1531?

Advanced structural biology techniques offer exciting opportunities to elucidate the transport mechanism of Dole_1531. This comprehensive research strategy outlines the most promising approaches:

• Cryo-Electron Microscopy (Cryo-EM):

  • Single Particle Analysis:

    • Use of Volta phase plates to enhance contrast for this relatively small protein

    • Application of focused classification to capture different conformational states

    • Implementation of tilted data collection for preferred orientation issues

  • Tomography Approaches:

    • In situ structural determination in native-like membranes

    • Subtomogram averaging to enhance resolution

    • Correlation with functional states in proteoliposomes

• X-ray Crystallography:

  • Advanced Crystallization Methods:

    • Lipidic cubic phase (LCP) crystallization optimized for Dole_1531

    • Crystal engineering using antibody fragments or nanobodies

    • Implementation of serial crystallography at XFELs

  • Functional State Capture:

    • Crystallization with manganese and transport inhibitors

    • Use of stabilizing mutations to trap specific conformations

    • Time-resolved crystallography to capture transport intermediates

• NMR Spectroscopy:

  • Solution NMR Applications:

    • Analysis of detergent-solubilized protein dynamics

    • Chemical shift perturbation to map metal binding sites

    • Relaxation dispersion to identify microsecond-millisecond motions

  • Solid-State NMR:

    • Structure determination in native-like lipid environments

    • Investigation of protein-lipid interactions

    • Measurement of distance constraints in different functional states

• Hybrid Methods Integration:

  • Integrative Structural Biology:

    • Combination of low-resolution EM maps with high-resolution domain structures

    • Cross-validation using multiple structural techniques

    • Integration of computational models with experimental constraints

  • Correlative Microscopy:

    • Linking structural data with functional transport assays

    • Fluorescence-guided structural analysis

    • Single-molecule approaches to capture rare conformations

• Advanced Spectroscopic Techniques:

  • EPR Spectroscopy:

    • DEER/PELDOR measurements to track conformational changes

    • Site-directed spin labeling of key residues

    • Paramagnetic relaxation enhancement to map metal binding

  • FRET-Based Approaches:

    • smFRET to monitor conformational dynamics

    • TR-FRET to capture transport-associated motions

    • FRET sensors integrated into proteoliposomes

This multi-technique structural biology approach will provide complementary insights into the Dole_1531 transport mechanism, capturing both static structural features and dynamic aspects critical for understanding metal transport across membranes.

What interdisciplinary approaches could accelerate our understanding of the UPF0059 membrane protein family, including Dole_1531?

Accelerating our understanding of the UPF0059 membrane protein family, including Dole_1531, requires innovative interdisciplinary approaches that bridge multiple scientific domains. This comprehensive strategy outlines the most promising interdisciplinary directions:

• Computational-Experimental Integration:

  • AI-Driven Structure Prediction:

    • Application of AlphaFold2 and RoseTTAFold to the UPF0059 family

    • Validation of predicted structures through targeted experiments

    • Development of specialized membrane protein prediction algorithms

  • Molecular Dynamics Simulations:

    • Microsecond-scale simulations of transport processes

    • Free energy calculations for metal binding and permeation

    • Integration with experimental validation points

• Synthetic Biology Approaches:

  • Minimal Transporter Engineering:

    • Design of simplified transporters based on UPF0059 core elements

    • Creation of chimeric proteins with other transporter families

    • Development of biosensors based on conformational changes

  • Directed Evolution:

    • High-throughput screening for enhanced stability variants

    • Selection for altered metal selectivity

    • Evolution of crystallization-amenable constructs

• Systems and Network Biology:

  • Multi-omics Integration:

    • Correlation of transcriptomics, proteomics, and metallomics data

    • Network modeling of metal homeostasis systems

    • Identification of emergent properties in metal regulation

  • Cross-Species Comparative Analysis:

    • Functional genomics across bacterial phyla

    • Correlation of transporter properties with ecological niches

    • Evolutionary trajectory mapping of the UPF0059 family

• Advanced Biophysical Methods:

  • Single-Molecule Approaches:

    • Patch-clamp of reconstituted transporters

    • Optical tweezers to measure conformational forces

    • High-speed AFM to visualize transport dynamics

  • Label-Free Detection:

    • Surface plasmon resonance for metal binding kinetics

    • Quartz crystal microbalance with proteoliposomes

    • Nanopore-based transport monitoring

• Translational Applications:

  • Medical Biotechnology:

    • Development of inhibitors targeting pathogen metal homeostasis

    • Engineering bacteria with modified metal handling for probiotics

    • Metal-based antimicrobial strategies targeting transporters

  • Environmental Biotechnology:

    • Bioengineering for enhanced metal bioremediation

    • Development of whole-cell biosensors for environmental monitoring

    • Creation of robust biocatalysts with improved metal handling

This integrated interdisciplinary approach leverages complementary expertise and methodologies across scientific domains, potentially accelerating our understanding of the UPF0059 family and opening new avenues for applications in biotechnology, medicine, and environmental science.