Recombinant Desulfococcus oleovorans UPF0365 protein Dole_0018 (Dole_0018) is a protein derived from the bacterium Desulfococcus oleovorans . D. oleovorans is a bacterium from the genus Desulfococcus and was isolated from mud in an oilfield near Hamburg, Germany . Strain Hxd3 of D. oleovorans was isolated from the saline water phase of an oil-water separator in a northern German oil field and can utilize C12-C20 alkanes as growth substrates .
AA Sequence: MNPNYIILFFLVVAVIVLFYFVGSSVSLWIQALVSGARVGLLNIVFMRFRKVPPKLIVES KIMATKAGLDISSDELESHYLAGGNVSRVVQALIAADKAKIELSFNRSAAIDLAGRDVLE AVQMSVNPKVIETPMIAAMAKDGIQLKAISRVTVRANIDRLVGGAGEETILARVGEGIVT TIGSADSHKHVLENPDLISKRVLEKGLDSGTAFEILSIDIADVDVGKNIGAELETDRAEA DKKIAQAKAEERRAMAYAREQEMKAQVEEMRAKVVEAEAKIPLAMANAFEKGNLGIMDYY RMKNIMADTQMRDTIGSPDRETPREK
Recombinant Full Length Desulfococcus oleovorans UPF0365 protein Dole_0018 (Dole_0018) Protein (A8ZRR1) (1-326aa), fused to N-terminal His tag, was expressed in E. coli .
It is recommended to store the protein at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses and to avoid repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week .
Typically supplied in Tris/PBS-based buffer, 6% Trehalose, pH 8.0 or Tris-based buffer, 50% glycerol, optimized for this protein . It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .
Desulfococcus oleovorans is notable for its ability to utilize C12-C20 alkanes as growth substrates . Alkane degradation in Hxd3 involves the activation of alkanes via carboxylation at C3, with subsequent elimination of the terminal and subterminal carbons, yielding a fatty acid that is one carbon shorter than the parent alkane . Hxd3 is the only pure culture known to carboxylate aliphatic hydrocarbons .
Recombinant Desulfococcus oleovorans UPF0365 protein Dole_0018 can be employed in various research and development applications, including:
Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are considered crucial for maintaining membrane fluidity.
KEGG: dol:Dole_0018
STRING: 96561.Dole_0018
Isolation of Desulfococcus oleovorans requires specialized techniques similar to those used for related bacterial species like Pseudomonas oleovorans. For optimal isolation, researchers should:
Collect samples from industrial wastewater with high sulfate compound concentrations
Use selective media enriched with petroleum-based carbon sources
Incubate under anaerobic conditions at 30-37°C for 48-72 hours
Perform initial screening using biochemical tests (similar to ADH, MTE, CIT, MLT, ONPG, and ACE tests used for Pseudomonas)
Confirm identity using both matrix-assisted flight mass spectrometry and 16S rDNA sequencing
This approach ensures reliable isolation while minimizing contamination from other bacterial species. The cultivation process should be carefully monitored, as growth patterns typically show an initial increase followed by a decrease around 20 hours, then a secondary growth peak around 23 hours post-inoculation .
Expression optimization for recombinant Dole_0018 protein requires careful consideration of several factors:
Analyze protein sequence for hydrophobicity and rare codons that may affect expression
Select an appropriate expression system based on protein characteristics:
Prokaryotic systems (E. coli) for rapid expression
Eukaryotic systems for complex proteins requiring post-translational modifications
Design fusion tags to improve solubility and facilitate purification
Use expression vectors with fusion labels on both N and C termini to distinguish full-length proteins from truncated products
Optimize expression conditions (temperature, inducer concentration, expression time)
Researchers should be aware that highly hydrophobic regions or clusters of rare codons may significantly impact expression efficiency. To address potential translation initiation problems, increasing imidazole concentration during elution can help distinguish full-length proteins from truncated variants .
Essential characterization techniques include:
SDS-PAGE for molecular weight confirmation and initial purity assessment
Western blot using specific antibodies for identity verification
Mass spectrometry for accurate molecular weight determination and sequence verification
Circular dichroism (CD) spectroscopy for secondary structure analysis
Size exclusion chromatography for oligomerization state determination and purity assessment
For comprehensive characterization, researchers should conduct both biochemical and biophysical analyses. Similar to approaches used for other proteins, proteomics analysis may be necessary to identify specific protein markers associated with Dole_0018 . This multi-technique approach ensures both the identity and structural integrity of the recombinant protein.
When designing experiments to investigate Dole_0018's role in sulfate metabolism, researchers should implement a systematic Design of Experiments (DOE) approach:
Identify key variables affecting protein function (pH, temperature, substrate concentrations, cofactors)
Design a full factorial experimental matrix to assess main effects and interactions
Apply response surface methodology to optimize conditions and identify critical parameters
Implement statistical controls to minimize experimental bias
| Experimental Factor | Low Level | Mid Level | High Level |
|---|---|---|---|
| pH | 5.5 | 7.0 | 8.5 |
| Temperature (°C) | 25 | 35 | 45 |
| Sulfate Conc. (mM) | 1 | 10 | 50 |
| Protein Conc. (μM) | 0.1 | 1.0 | 10 |
For comprehensive analysis, researchers should employ interaction plots and main effects plots to visualize data relationships . This approach allows for the identification of optimal conditions while minimizing the number of experiments required. When interpreting results, consider that observations may be dependent while models may assume independence, necessitating appropriate statistical analysis methods .
For structure-function relationship analysis of Dole_0018:
Apply a multi-technique structural biology approach:
Conduct site-directed mutagenesis of conserved residues to correlate structure with function
Perform molecular dynamics simulations to investigate conformational changes
Use advanced labeling techniques (FRET, crosslinking) to examine protein-protein interactions
Combine structural data with biochemical assays to establish structure-function relationships
The integration of computational predictions with experimental validation is particularly powerful. Recent advances in AI-based protein structure prediction have dramatically improved our ability to model proteins like Dole_0018, though multi-domain proteins and complexes still present challenges . When publishing findings, include both experimental structural data and computational models with appropriate validation metrics.
When faced with contradictory findings:
Perform comprehensive statistical analysis to identify potential sources of variation:
Sample preparation inconsistencies
Batch-to-batch protein variation
Environmental factors affecting experiments
Implement label distance metrics to quantify differences in distributions between experimental groups
Apply sample-based metrics to correctly evaluate performance in terms of data subjects
Investigate demographic variables that might influence results, similar to approaches used in medical studies
Design follow-up experiments specifically targeting areas of inconsistency
Researchers should be aware that when studying proteins like Dole_0018, apparent contradictions often arise from subtle differences in experimental conditions or sample preparation. The correlation between sample size and performance outcomes should be carefully evaluated, as should the distribution patterns across experimental groups . Document all potential confounding variables and their possible impacts on results.
To analyze drug resistance patterns:
Conduct antibiotic sensitivity testing using standardized methods:
Perform genomic analysis to identify potential resistance genes:
Use proteomic approaches to identify resistance-related proteins:
Validate findings using gene knockout or overexpression studies
Recent studies on related organisms have shown that proteins such as mdtA2, mdtA3, mdtB2, mdaB, and emrK1 are closely associated with drug resistance mechanisms . Understanding these patterns in Desulfococcus oleovorans could provide valuable insights into the function of Dole_0018 and its potential role in antibiotic resistance pathways.
When facing inclusion body formation:
Implement a systematic refolding strategy:
Solubilize inclusion bodies using 8M urea or 6M guanidine hydrochloride
Remove denaturants through step-wise dialysis or rapid dilution
Add appropriate redox agents to facilitate disulfide bond formation
Include stabilizing additives (L-arginine, glycerol) during refolding
Modify expression conditions to enhance solubility:
Lower induction temperature (16-25°C)
Reduce inducer concentration
Co-express with molecular chaperones
Use solubility-enhancing fusion tags (MBP, SUMO, Thioredoxin)
Assess protein activity after each refolding approach
This challenge is common with full-length proteins, particularly those with hydrophobic regions. As noted in research on similar proteins, factors including protein hydrophilicity, codon rarity, and protein toxicity can all influence expression outcomes . Researchers should analyze the protein sequence and secondary structure to optimize expression and refolding strategies accordingly.
To characterize protein-protein interactions:
Apply Design of Experiments (DOE) principles:
Select appropriate interaction detection methods:
Surface Plasmon Resonance (SPR) for real-time kinetics
Isothermal Titration Calorimetry (ITC) for thermodynamic parameters
Microscale Thermophoresis (MST) for interactions in complex solutions
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) for mapping interaction surfaces
Validate interactions through orthogonal methods:
Co-immunoprecipitation
FRET/BRET assays
Crosslinking mass spectrometry
The experimental design should follow the principle of collecting data "as parsimoniously as possible while providing sufficient information to accurately estimate model parameters" . This approach ensures efficient use of resources while generating robust, reproducible data on Dole_0018's interaction network.
For gene knockout studies:
Select appropriate genetic manipulation techniques:
CRISPR-Cas9 for precise genomic editing
Homologous recombination for gene replacement
Transposon mutagenesis for random knockout screening
Design proper controls:
Wild-type strains
Strains with knockout of unrelated genes
Complementation strains (knockout + gene reintroduction)
Implement comprehensive phenotypic analysis:
Validate knockout at both DNA and protein levels
When interpreting results, researchers should consider potential compensatory mechanisms and polar effects on downstream genes. The growth patterns observed in knockout strains should be carefully compared with wild-type growth curves, which typically show specific patterns of increase and decrease over cultivation periods .
For statistical analysis of complex datasets:
Implement appropriate experimental design:
Select suitable statistical methods:
ANOVA for comparing multiple experimental conditions
Regression analysis for establishing relationships between variables
Principal Component Analysis (PCA) for dimensionality reduction
Cluster analysis for identifying patterns in multivariate data
Validate statistical models:
Cross-validation techniques
Residual analysis
Outlier detection and handling
Consider demographic variables that might influence outcomes
The analysis should address potential issues of passive data collection, including correlations that may not indicate causation and interactions between multiple factors that are difficult to separate . Researchers should also be aware of potential dependencies in observations that might violate independence assumptions in statistical models.
For integrated multi-omics analysis:
Combine data from multiple sources:
Structural data (X-ray, NMR, Cryo-EM, computational models)
Functional assays (enzymatic activity, binding studies)
Evolutionary analysis (sequence conservation, phylogenetic relationships)
Expression profiles under different conditions
Apply integrative computational tools:
Network analysis to identify functional relationships
Machine learning approaches to predict functions from integrated datasets
Evolutionary coupling analysis to identify co-evolving residues
Validate predictions experimentally:
Site-directed mutagenesis of predicted functional sites
Chimeric protein construction to test domain functions
Cross-species complementation studies
Develop visualizations that effectively communicate integrated findings
This integrated approach is particularly valuable as it leverages multiple data types to develop a comprehensive understanding of Dole_0018. The combination of computational predictions with experimental validation, as highlighted in research on full-length proteins, represents a powerful strategy for characterizing proteins with unknown functions .
When troubleshooting inconsistent activity assays:
Systematically evaluate all assay components:
Protein quality (purity, stability, proper folding)
Substrate quality and stability
Buffer composition (pH, ionic strength, additives)
Detection system reliability
Implement proper controls:
Positive and negative controls
Internal standards
Time-course measurements to ensure linearity
Assess potential interfering factors:
Presence of inhibitors
Protein aggregation
Cofactor availability
Oxidation or other chemical modifications
Apply Design of Experiments (DOE) to identify critical factors affecting assay reproducibility
Researchers should document all troubleshooting steps and observations in detail. The approach to improving assay reliability should parallel the philosophy of designed experiments, where "the data-producing process is actively manipulated to improve the quality of information and to eliminate redundant data" . This systematic approach will lead to more consistent and reliable activity measurements.
For bioremediation applications research:
Design experiments to assess biodegradation capabilities:
Test various pollutants as potential substrates
Measure degradation rates under different conditions
Evaluate toxicity thresholds
Assess performance in complex environmental matrices
Compare with known bioremediation organisms:
Implement microcosm and mesocosm studies:
Design scaled experiments mimicking environmental conditions
Monitor long-term stability and performance
Assess ecological impacts
The knowledge that related organisms like Pseudomonas oleovorans have been studied for petroleum pollutant treatment provides valuable context for investigating Dole_0018's potential role in bioremediation . Researchers should design experiments that build upon this established knowledge while addressing the unique properties of Desulfococcus oleovorans.
To improve structural predictions:
Apply state-of-the-art computational approaches:
Address specific challenges:
Multi-domain protein structure prediction
Modeling of protein-protein complexes
Prediction of conformational changes upon binding or activation
Validate computational models experimentally:
Limited proteolysis to identify domain boundaries
Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe solvent accessibility
Cross-linking mass spectrometry (XL-MS) to identify spatial proximities
Iteratively refine models based on experimental feedback
For post-translational modification (PTM) analysis:
Apply comprehensive mass spectrometry-based approaches:
Enrichment strategies for specific PTMs (phosphorylation, glycosylation, etc.)
Multiple proteolytic digestions to improve sequence coverage
Different fragmentation methods (CID, ETD, HCD) for PTM characterization
Top-down proteomics for intact protein analysis
Investigate PTM dynamics:
Compare PTM profiles under different conditions
Monitor temporal changes in modification patterns
Assess the impact of potential environmental stressors
Validate biological significance:
Site-directed mutagenesis of modified residues
Functional assays comparing wild-type and mutant proteins
Structural analysis to determine PTM impact on protein conformation
Identify enzymes responsible for adding/removing PTMs