Recombinant Desulfococcus oleovorans UPF0365 protein Dole_0018 (Dole_0018)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Desulfococcus oleovorans UPF0365 protein Dole_0018 (Dole_0018) is a protein derived from the bacterium Desulfococcus oleovorans . D. oleovorans is a bacterium from the genus Desulfococcus and was isolated from mud in an oilfield near Hamburg, Germany . Strain Hxd3 of D. oleovorans was isolated from the saline water phase of an oil-water separator in a northern German oil field and can utilize C12-C20 alkanes as growth substrates .

Basic Characteristics

  • Species: Desulfococcus oleovorans (strain DSM 6200 / Hxd3)

  • UniProt ID: A8ZRR1

  • Gene Name: dole_0018

  • Synonyms: floA; Dole_0018; Flotillin-like protein FloA

  • Protein Names: UPF0365 protein Dole_0018

  • AA Sequence: MNPNYIILFFLVVAVIVLFYFVGSSVSLWIQALVSGARVGLLNIVFMRFRKVPPKLIVES KIMATKAGLDISSDELESHYLAGGNVSRVVQALIAADKAKIELSFNRSAAIDLAGRDVLE AVQMSVNPKVIETPMIAAMAKDGIQLKAISRVTVRANIDRLVGGAGEETILARVGEGIVT TIGSADSHKHVLENPDLISKRVLEKGLDSGTAFEILSIDIADVDVGKNIGAELETDRAEA DKKIAQAKAEERRAMAYAREQEMKAQVEEMRAKVVEAEAKIPLAMANAFEKGNLGIMDYY RMKNIMADTQMRDTIGSPDRETPREK

  • Expression Region: 1-326

  • Protein Length : Full Length (1-326)

  • Source: E. coli

  • Tag: His

  • Form: Lyophilized powder

  • Purity: Greater than 90% as determined by SDS-PAGE

Production and Sorage

  • Recombinant Full Length Desulfococcus oleovorans UPF0365 protein Dole_0018 (Dole_0018) Protein (A8ZRR1) (1-326aa), fused to N-terminal His tag, was expressed in E. coli .

  • It is recommended to store the protein at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses and to avoid repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week .

  • Typically supplied in Tris/PBS-based buffer, 6% Trehalose, pH 8.0 or Tris-based buffer, 50% glycerol, optimized for this protein . It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .

Biological Role and Significance

Desulfococcus oleovorans is notable for its ability to utilize C12-C20 alkanes as growth substrates . Alkane degradation in Hxd3 involves the activation of alkanes via carboxylation at C3, with subsequent elimination of the terminal and subterminal carbons, yielding a fatty acid that is one carbon shorter than the parent alkane . Hxd3 is the only pure culture known to carboxylate aliphatic hydrocarbons .

Applications

Recombinant Desulfococcus oleovorans UPF0365 protein Dole_0018 can be employed in various research and development applications, including:

  • ELISA assays

  • As a protein standard for research purposes

  • Studying protein interactions

  • Structural biology research

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
floA; Dole_0018; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-326
Protein Length
full length protein
Species
Desulfococcus oleovorans (strain DSM 6200 / Hxd3)
Target Names
Dole_0018
Target Protein Sequence
MNPNYIILFFLVVAVIVLFYFVGSSVSLWIQALVSGARVGLLNIVFMRFRKVPPKLIVES KIMATKAGLDISSDELESHYLAGGNVSRVVQALIAADKAKIELSFNRSAAIDLAGRDVLE AVQMSVNPKVIETPMIAAMAKDGIQLKAISRVTVRANIDRLVGGAGEETILARVGEGIVT TIGSADSHKHVLENPDLISKRVLEKGLDSGTAFEILSIDIADVDVGKNIGAELETDRAEA DKKIAQAKAEERRAMAYAREQEMKAQVEEMRAKVVEAEAKIPLAMANAFEKGNLGIMDYY RMKNIMADTQMRDTIGSPDRETPREK
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are considered crucial for maintaining membrane fluidity.

Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What are the optimal methods for isolating Desulfococcus oleovorans from environmental samples?

Isolation of Desulfococcus oleovorans requires specialized techniques similar to those used for related bacterial species like Pseudomonas oleovorans. For optimal isolation, researchers should:

  • Collect samples from industrial wastewater with high sulfate compound concentrations

  • Use selective media enriched with petroleum-based carbon sources

  • Incubate under anaerobic conditions at 30-37°C for 48-72 hours

  • Perform initial screening using biochemical tests (similar to ADH, MTE, CIT, MLT, ONPG, and ACE tests used for Pseudomonas)

  • Confirm identity using both matrix-assisted flight mass spectrometry and 16S rDNA sequencing

This approach ensures reliable isolation while minimizing contamination from other bacterial species. The cultivation process should be carefully monitored, as growth patterns typically show an initial increase followed by a decrease around 20 hours, then a secondary growth peak around 23 hours post-inoculation .

How should researchers optimize expression conditions for recombinant Dole_0018 protein?

Expression optimization for recombinant Dole_0018 protein requires careful consideration of several factors:

  • Analyze protein sequence for hydrophobicity and rare codons that may affect expression

  • Select an appropriate expression system based on protein characteristics:

    • Prokaryotic systems (E. coli) for rapid expression

    • Eukaryotic systems for complex proteins requiring post-translational modifications

  • Design fusion tags to improve solubility and facilitate purification

  • Use expression vectors with fusion labels on both N and C termini to distinguish full-length proteins from truncated products

  • Optimize expression conditions (temperature, inducer concentration, expression time)

Researchers should be aware that highly hydrophobic regions or clusters of rare codons may significantly impact expression efficiency. To address potential translation initiation problems, increasing imidazole concentration during elution can help distinguish full-length proteins from truncated variants .

What characterization techniques are essential for confirming the identity and purity of recombinant Dole_0018?

Essential characterization techniques include:

  • SDS-PAGE for molecular weight confirmation and initial purity assessment

  • Western blot using specific antibodies for identity verification

  • Mass spectrometry for accurate molecular weight determination and sequence verification

  • Circular dichroism (CD) spectroscopy for secondary structure analysis

  • Size exclusion chromatography for oligomerization state determination and purity assessment

For comprehensive characterization, researchers should conduct both biochemical and biophysical analyses. Similar to approaches used for other proteins, proteomics analysis may be necessary to identify specific protein markers associated with Dole_0018 . This multi-technique approach ensures both the identity and structural integrity of the recombinant protein.

How should researchers design experiments to investigate the functional role of Dole_0018 in sulfate metabolism?

When designing experiments to investigate Dole_0018's role in sulfate metabolism, researchers should implement a systematic Design of Experiments (DOE) approach:

  • Identify key variables affecting protein function (pH, temperature, substrate concentrations, cofactors)

  • Design a full factorial experimental matrix to assess main effects and interactions

  • Apply response surface methodology to optimize conditions and identify critical parameters

  • Implement statistical controls to minimize experimental bias

Experimental FactorLow LevelMid LevelHigh Level
pH5.57.08.5
Temperature (°C)253545
Sulfate Conc. (mM)11050
Protein Conc. (μM)0.11.010

For comprehensive analysis, researchers should employ interaction plots and main effects plots to visualize data relationships . This approach allows for the identification of optimal conditions while minimizing the number of experiments required. When interpreting results, consider that observations may be dependent while models may assume independence, necessitating appropriate statistical analysis methods .

What approaches are most effective for resolving structural features of Dole_0018 and correlating them with function?

For structure-function relationship analysis of Dole_0018:

  • Apply a multi-technique structural biology approach:

    • X-ray crystallography for high-resolution static structure

    • NMR spectroscopy for dynamic properties in solution

    • Cryo-EM for larger assemblies or membrane-associated states

    • Computational modeling using AI-based prediction tools like AlphaFold2

  • Conduct site-directed mutagenesis of conserved residues to correlate structure with function

  • Perform molecular dynamics simulations to investigate conformational changes

  • Use advanced labeling techniques (FRET, crosslinking) to examine protein-protein interactions

  • Combine structural data with biochemical assays to establish structure-function relationships

The integration of computational predictions with experimental validation is particularly powerful. Recent advances in AI-based protein structure prediction have dramatically improved our ability to model proteins like Dole_0018, though multi-domain proteins and complexes still present challenges . When publishing findings, include both experimental structural data and computational models with appropriate validation metrics.

How can researchers address inconsistent data or contradictory findings when studying Dole_0018?

When faced with contradictory findings:

  • Perform comprehensive statistical analysis to identify potential sources of variation:

    • Sample preparation inconsistencies

    • Batch-to-batch protein variation

    • Environmental factors affecting experiments

  • Implement label distance metrics to quantify differences in distributions between experimental groups

  • Apply sample-based metrics to correctly evaluate performance in terms of data subjects

  • Investigate demographic variables that might influence results, similar to approaches used in medical studies

  • Design follow-up experiments specifically targeting areas of inconsistency

Researchers should be aware that when studying proteins like Dole_0018, apparent contradictions often arise from subtle differences in experimental conditions or sample preparation. The correlation between sample size and performance outcomes should be carefully evaluated, as should the distribution patterns across experimental groups . Document all potential confounding variables and their possible impacts on results.

What are the appropriate methods for analyzing drug resistance patterns in Desulfococcus oleovorans and identifying resistance-related proteins?

To analyze drug resistance patterns:

  • Conduct antibiotic sensitivity testing using standardized methods:

    • Determine minimum inhibitory concentrations (MICs)

    • Assess resistance profiles against multiple antibiotics

    • Compare results with related species like Pseudomonas oleovorans

  • Perform genomic analysis to identify potential resistance genes:

    • Target known resistance genes like gyrB

    • Conduct whole genome sequencing and comparative genomics

  • Use proteomic approaches to identify resistance-related proteins:

    • Look for proteins like mdtA2, mdtA3, mdtB2, mdaB, and emrK1 that have been associated with drug resistance in related species

    • Perform differential expression analysis under antibiotic pressure

  • Validate findings using gene knockout or overexpression studies

Recent studies on related organisms have shown that proteins such as mdtA2, mdtA3, mdtB2, mdaB, and emrK1 are closely associated with drug resistance mechanisms . Understanding these patterns in Desulfococcus oleovorans could provide valuable insights into the function of Dole_0018 and its potential role in antibiotic resistance pathways.

What strategies should be employed when expressing Dole_0018 results in inclusion bodies?

When facing inclusion body formation:

  • Implement a systematic refolding strategy:

    • Solubilize inclusion bodies using 8M urea or 6M guanidine hydrochloride

    • Remove denaturants through step-wise dialysis or rapid dilution

    • Add appropriate redox agents to facilitate disulfide bond formation

    • Include stabilizing additives (L-arginine, glycerol) during refolding

  • Modify expression conditions to enhance solubility:

    • Lower induction temperature (16-25°C)

    • Reduce inducer concentration

    • Co-express with molecular chaperones

    • Use solubility-enhancing fusion tags (MBP, SUMO, Thioredoxin)

  • Assess protein activity after each refolding approach

This challenge is common with full-length proteins, particularly those with hydrophobic regions. As noted in research on similar proteins, factors including protein hydrophilicity, codon rarity, and protein toxicity can all influence expression outcomes . Researchers should analyze the protein sequence and secondary structure to optimize expression and refolding strategies accordingly.

How can advanced experimental design improve the characterization of Dole_0018 interactions with potential binding partners?

To characterize protein-protein interactions:

  • Apply Design of Experiments (DOE) principles:

    • Identify critical factors affecting interaction (pH, ionic strength, temperature)

    • Use D-optimal designs to minimize experimental runs while maximizing information

    • Implement response surface methodology to model interaction landscapes

  • Select appropriate interaction detection methods:

    • Surface Plasmon Resonance (SPR) for real-time kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Microscale Thermophoresis (MST) for interactions in complex solutions

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) for mapping interaction surfaces

  • Validate interactions through orthogonal methods:

    • Co-immunoprecipitation

    • FRET/BRET assays

    • Crosslinking mass spectrometry

The experimental design should follow the principle of collecting data "as parsimoniously as possible while providing sufficient information to accurately estimate model parameters" . This approach ensures efficient use of resources while generating robust, reproducible data on Dole_0018's interaction network.

What considerations are important when designing gene knockout experiments to study Dole_0018 function?

For gene knockout studies:

  • Select appropriate genetic manipulation techniques:

    • CRISPR-Cas9 for precise genomic editing

    • Homologous recombination for gene replacement

    • Transposon mutagenesis for random knockout screening

  • Design proper controls:

    • Wild-type strains

    • Strains with knockout of unrelated genes

    • Complementation strains (knockout + gene reintroduction)

  • Implement comprehensive phenotypic analysis:

    • Growth curve analysis (similar to the 90-hour growth monitoring described for related species)

    • Biochemical property assessment

    • Stress response evaluation

    • Metabolomic profiling

  • Validate knockout at both DNA and protein levels

When interpreting results, researchers should consider potential compensatory mechanisms and polar effects on downstream genes. The growth patterns observed in knockout strains should be carefully compared with wild-type growth curves, which typically show specific patterns of increase and decrease over cultivation periods .

How should researchers approach statistical analysis of complex datasets generated from Dole_0018 functional studies?

For statistical analysis of complex datasets:

  • Implement appropriate experimental design:

    • Full factorial or fractional factorial designs to identify significant factors

    • D-optimal designs for non-standard models or constraints

    • Response surface designs for optimization studies

  • Select suitable statistical methods:

    • ANOVA for comparing multiple experimental conditions

    • Regression analysis for establishing relationships between variables

    • Principal Component Analysis (PCA) for dimensionality reduction

    • Cluster analysis for identifying patterns in multivariate data

  • Validate statistical models:

    • Cross-validation techniques

    • Residual analysis

    • Outlier detection and handling

  • Consider demographic variables that might influence outcomes

The analysis should address potential issues of passive data collection, including correlations that may not indicate causation and interactions between multiple factors that are difficult to separate . Researchers should also be aware of potential dependencies in observations that might violate independence assumptions in statistical models.

What approaches are recommended for integrating structural, functional, and evolutionary data when characterizing Dole_0018?

For integrated multi-omics analysis:

  • Combine data from multiple sources:

    • Structural data (X-ray, NMR, Cryo-EM, computational models)

    • Functional assays (enzymatic activity, binding studies)

    • Evolutionary analysis (sequence conservation, phylogenetic relationships)

    • Expression profiles under different conditions

  • Apply integrative computational tools:

    • Network analysis to identify functional relationships

    • Machine learning approaches to predict functions from integrated datasets

    • Evolutionary coupling analysis to identify co-evolving residues

  • Validate predictions experimentally:

    • Site-directed mutagenesis of predicted functional sites

    • Chimeric protein construction to test domain functions

    • Cross-species complementation studies

  • Develop visualizations that effectively communicate integrated findings

This integrated approach is particularly valuable as it leverages multiple data types to develop a comprehensive understanding of Dole_0018. The combination of computational predictions with experimental validation, as highlighted in research on full-length proteins, represents a powerful strategy for characterizing proteins with unknown functions .

How can researchers effectively troubleshoot inconsistent activity assays for Dole_0018?

When troubleshooting inconsistent activity assays:

  • Systematically evaluate all assay components:

    • Protein quality (purity, stability, proper folding)

    • Substrate quality and stability

    • Buffer composition (pH, ionic strength, additives)

    • Detection system reliability

  • Implement proper controls:

    • Positive and negative controls

    • Internal standards

    • Time-course measurements to ensure linearity

  • Assess potential interfering factors:

    • Presence of inhibitors

    • Protein aggregation

    • Cofactor availability

    • Oxidation or other chemical modifications

  • Apply Design of Experiments (DOE) to identify critical factors affecting assay reproducibility

Researchers should document all troubleshooting steps and observations in detail. The approach to improving assay reliability should parallel the philosophy of designed experiments, where "the data-producing process is actively manipulated to improve the quality of information and to eliminate redundant data" . This systematic approach will lead to more consistent and reliable activity measurements.

What considerations are important when designing experiments to study Dole_0018's potential role in bioremediation?

For bioremediation applications research:

  • Design experiments to assess biodegradation capabilities:

    • Test various pollutants as potential substrates

    • Measure degradation rates under different conditions

    • Evaluate toxicity thresholds

    • Assess performance in complex environmental matrices

  • Compare with known bioremediation organisms:

    • Benchmark against Pseudomonas oleovorans, which has established roles in petroleum pollutant treatment

    • Evaluate performance in industrial wastewater with high sulfate compounds

  • Implement microcosm and mesocosm studies:

    • Design scaled experiments mimicking environmental conditions

    • Monitor long-term stability and performance

    • Assess ecological impacts

  • Apply DOE approaches to optimize bioremediation conditions

The knowledge that related organisms like Pseudomonas oleovorans have been studied for petroleum pollutant treatment provides valuable context for investigating Dole_0018's potential role in bioremediation . Researchers should design experiments that build upon this established knowledge while addressing the unique properties of Desulfococcus oleovorans.

How should researchers approach the challenge of improving structural predictions for Dole_0018 using computational methods?

To improve structural predictions:

  • Apply state-of-the-art computational approaches:

    • AI-based structure prediction tools like AlphaFold2

    • Molecular dynamics simulations to sample conformational space

    • Integrative modeling incorporating sparse experimental data

  • Address specific challenges:

    • Multi-domain protein structure prediction

    • Modeling of protein-protein complexes

    • Prediction of conformational changes upon binding or activation

  • Validate computational models experimentally:

    • Limited proteolysis to identify domain boundaries

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe solvent accessibility

    • Cross-linking mass spectrometry (XL-MS) to identify spatial proximities

  • Iteratively refine models based on experimental feedback

What approaches are recommended for investigating post-translational modifications of Dole_0018?

For post-translational modification (PTM) analysis:

  • Apply comprehensive mass spectrometry-based approaches:

    • Enrichment strategies for specific PTMs (phosphorylation, glycosylation, etc.)

    • Multiple proteolytic digestions to improve sequence coverage

    • Different fragmentation methods (CID, ETD, HCD) for PTM characterization

    • Top-down proteomics for intact protein analysis

  • Investigate PTM dynamics:

    • Compare PTM profiles under different conditions

    • Monitor temporal changes in modification patterns

    • Assess the impact of potential environmental stressors

  • Validate biological significance:

    • Site-directed mutagenesis of modified residues

    • Functional assays comparing wild-type and mutant proteins

    • Structural analysis to determine PTM impact on protein conformation

  • Identify enzymes responsible for adding/removing PTMs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.