Recombinant Desulfococcus oleovorans Zinc transporter ZupT (zupT)

Shipped with Ice Packs
In Stock

Description

Functional Insights

  • Substrate Specificity: Primarily transports Zn(II), but homology studies suggest potential affinity for Fe(II) and Mn(II) .

  • Regulation: Unlike ZnuABC (a high-affinity zinc transporter), ZupT operates constitutively under varying zinc conditions, providing baseline metal uptake .

Research Applications

Recombinant ZupT is utilized in:

  • Metal Transport Studies: Investigating zinc homeostasis in anaerobic environments .

  • Enzyme-Linked Immunosorbent Assays (ELISA): Quantifying ZIP transporter expression levels in bacterial cultures .

  • Structural Biology: Crystallization trials to resolve ZIP family mechanisms .

Comparative Analysis with Homologs

FeatureD. oleovorans ZupTE. coli ZupTSalmonella ZupT
Gene RegulationConstitutiveConstitutiveInduced by Zn scarcity
Primary SubstrateZn(II)Zn(II), Cd(II)Zn(II), Fe(II)
Role in VirulenceNot characterizedLimitedCritical for host colonization

Handling and Stability

  • Lyophilized Form: Stable for 12 months at -80°C .

  • Reconstituted Protein: Stable for 1 week at 4°C; avoid repeated freeze-thaw cycles .

Limitations and Future Directions

While recombinant ZupT enables in vitro studies, its in vivo role in D. oleovorans remains uncharacterized. Future work should prioritize:

  1. Functional assays to confirm metal specificity.

  2. Structural analysis of Zn(II) binding pockets.

  3. Comparative studies with hydrocarbon degradation pathways in D. oleovorans .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific requests. Please indicate your desired format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is established during production. If you have a preference for a particular tag type, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
zupT; Dole_0856; Zinc transporter ZupT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Desulfococcus oleovorans (strain DSM 6200 / Hxd3)
Target Names
zupT
Target Protein Sequence
MSSILIALGLTLFAGMATGIGSAIAFFAKKQNYRFLSVATGFSAGVMLYVAFVEILAKGA TALARAYGEIPGAWINAAAFFGGILLIGVIDNLIPSAENPHEVPSETQMADFRDACTLSD TGAADCDDAGRKAKLLRMGLFTALAIGIHNFPEGLATFLAALSDPALGVAIALAIALHNI PEGISVSVPIFYATGNKTKAFAWSLVSGMAEPVGALLGYLGLLFFFGNPAGGMPPQIMGI LFAGVAGIMVYISVDELLPTSRAYGRGHDSILGMVAGMAVMAASLLMMK
Uniprot No.

Target Background

Function
This protein mediates zinc uptake and may also transport other divalent cations.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, ZupT subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological role of the ZupT transporter in Desulfococcus oleovorans?

ZupT functions as a low-affinity zinc importer in bacterial systems, playing a crucial role in zinc homeostasis. Based on studies in related bacterial species, ZupT in D. oleovorans likely facilitates zinc uptake in environments where this essential metal is present at moderate concentrations . Unlike high-affinity transporters that operate exclusively under severe zinc starvation, ZupT provides constitutive metal import capabilities, enabling bacteria to maintain appropriate intracellular zinc levels for cellular function and metabolism . In D. oleovorans, which thrives in oil-rich environments, this transporter may be particularly important for acquiring essential micronutrients in these specialized ecological niches .

How does the ZupT transporter differ structurally and functionally from high-affinity zinc transporters?

ZupT belongs to the ZIP (ZRT-, IRT-like Protein) family of transporters and exhibits broader metal specificity compared to high-affinity systems like ZnuABC. Structural analysis indicates that while ZupT demonstrates preference for zinc, it can also transport manganese, copper, and iron . Unlike the ZnuABC system, which is strictly regulated and produced only under zinc starvation conditions, ZupT expression appears to be constitutive in bacteria such as E. coli, providing continuous metal import capability . Functionally, ZupT likely relies on the proton motive force to drive metal uptake, as evidenced by its inhibition by ionophores in experimental systems . This structural and functional versatility makes ZupT an important component of bacterial metal homeostasis networks, complementing high-affinity transporters in varying environmental conditions.

What experimental approaches are recommended for confirming ZupT activity in recombinant D. oleovorans systems?

To confirm ZupT activity in recombinant D. oleovorans systems, researchers should employ a multi-faceted experimental approach:

  • Growth assays in metal-defined media: Compare growth rates of wild-type, ZupT knockout, and recombinant ZupT-expressing strains in media with controlled zinc concentrations. Significant growth impairment in knockout strains grown in metal-devoid environments would indicate ZupT functionality .

  • Zinc uptake measurements: Utilize radioactive 65Zn to quantify transport kinetics, or employ zinc-specific fluorescent probes to measure intracellular zinc accumulation in different strains.

  • Stress response analysis: Assess oxidative stress sensitivity, as ZupT mutants have shown hypersensitivity to oxidative stress conditions .

  • Intracellular zinc quantification: Measure free zinc levels using techniques such as inductively coupled plasma mass spectrometry (ICP-MS) or zinc-specific fluorescent probes like FluoZin-3.

These approaches should be conducted with appropriate controls and under varied zinc concentrations to establish the specific contribution of ZupT to zinc homeostasis in D. oleovorans.

What are the optimal conditions for heterologous expression and purification of recombinant D. oleovorans ZupT?

The optimal conditions for heterologous expression and purification of recombinant D. oleovorans ZupT require careful consideration of several factors:

Expression system selection:

  • For membrane proteins like ZupT, E. coli expression systems (BL21(DE3), C41(DE3), or C43(DE3)) are recommended due to their ability to handle membrane protein overexpression.

  • Consider using pET vector systems with tunable promoters to control expression levels and prevent toxicity.

Expression conditions:

  • Lower induction temperatures (16-25°C) often improve proper folding of membrane proteins.

  • Induction at mid-log phase (OD600 = 0.6-0.8) with reduced IPTG concentrations (0.1-0.5 mM) can enhance functional protein yield.

  • Supplementation with 0.5-1 mM ZnSO4 during expression may stabilize the transporter.

Purification strategy:

  • Extract membrane fraction using differential centrifugation

  • Solubilize using mild detergents (DDM, LMNG, or C12E8)

  • Employ immobilized metal affinity chromatography (IMAC) with His-tag

  • Further purify via size exclusion chromatography

Protein stability considerations:

  • Maintain 0.1-0.5 mM zinc in all purification buffers

  • Include glycerol (10-20%) to enhance stability

  • Consider protein stabilization additives such as cholesteryl hemisuccinate

Quality assessment should include SDS-PAGE, Western blotting, and functional assays to verify transporter activity in proteoliposomes or nanodiscs before proceeding to structural or functional studies.

How can researchers effectively generate and validate a zupT knockout strain in D. oleovorans?

Generating and validating a zupT knockout strain in D. oleovorans requires a systematic approach with multiple validation steps:

Generation strategies:

  • CRISPR-Cas9 approach:

    • Design guide RNAs targeting the zupT gene with minimal off-target effects

    • Introduce a repair template with selectable marker

    • Transform into D. oleovorans using electroporation optimized for anaerobic bacteria

    • Select transformants under anaerobic conditions on appropriate media

  • Homologous recombination approach:

    • Create a knockout cassette containing antibiotic resistance gene flanked by homologous regions (>500 bp) upstream and downstream of zupT

    • Introduce via conjugation or electroporation

    • Select using appropriate antibiotics under anaerobic conditions

Validation methods:

  • Genotypic confirmation:

    • PCR verification with primers spanning the deletion junction

    • Whole-genome sequencing to confirm single deletion without off-target effects

    • RT-qPCR to verify absence of zupT transcripts

  • Phenotypic validation:

    • Growth curve analysis in zinc-limited versus zinc-replete media

    • Metal sensitivity assays comparing wild-type and knockout strains

    • Complementation studies to restore wild-type phenotype

    • Intracellular zinc measurement using zinc-specific fluorescent probes

  • Functional assays:

    • Zinc uptake experiments using 65Zn

    • Oxidative stress tolerance tests, as ZupT mutants show increased sensitivity

    • Enzyme activity assays for zinc-dependent metalloenzymes

Controls to include:

  • Wild-type strain

  • Complemented mutant strain (knockout with zupT reintroduced)

  • Double knockout (znuABC zupT) to assess contributions of different zinc transport systems

This comprehensive validation approach ensures that observed phenotypes are specifically attributable to zupT deletion rather than polar effects or secondary mutations.

What methodological approaches can identify the metal specificity profile of D. oleovorans ZupT compared to other bacterial ZupT transporters?

To establish the metal specificity profile of D. oleovorans ZupT and compare it with ZupT transporters from other bacterial species, researchers should employ multiple complementary approaches:

In vitro transport assays:

  • Reconstituted system studies:

    • Purify recombinant ZupT and reconstitute into proteoliposomes or nanodiscs

    • Perform transport assays using radioactive metal isotopes (65Zn, 55Fe, 64Cu, 54Mn)

    • Measure transport rates under controlled pH and membrane potential conditions

    • Determine kinetic parameters (Km, Vmax) for each metal substrate

  • Competition assays:

    • Assess transport inhibition profiles using non-radioactive competing metals

    • Calculate IC50 values to quantify relative affinities

In vivo approaches:

  • Metal sensitivity assays:

    • Compare growth of wild-type, ZupT-knockout, and ZupT-complemented strains under varying concentrations of different metals

    • Assess toxicity thresholds for each metal in different strains

  • Metal accumulation studies:

    • Measure intracellular accumulation of different metals using ICP-MS

    • Compare metal profiles between wild-type and ZupT mutant strains

Structural studies:

  • Site-directed mutagenesis:

    • Identify and modify putative metal-binding residues

    • Assess impact on transport specificity

    • Create chimeric transporters with domains from other bacterial ZupT proteins

Data analysis approach:

  • Generate comprehensive metal specificity profiles using radar charts

  • Perform hierarchical clustering analysis to compare ZupT transporters across species

  • Conduct molecular dynamics simulations to understand structural basis of selectivity

Example data table comparing metal transport efficiency:

Metal IonD. oleovorans ZupTE. coli ZupTSalmonella ZupT
Zn2+100% (reference)100%100%
Fe2+[Relative %]42%[Relative %]
Mn2+[Relative %]35%[Relative %]
Cu2+[Relative %]28%[Relative %]
Cd2+[Relative %]<10%[Relative %]

By systematically applying these approaches, researchers can establish a comprehensive understanding of the metal specificity profile of D. oleovorans ZupT and make meaningful comparisons with ZupT transporters from other bacterial species.

How should researchers design experiments to investigate the role of recombinant ZupT in D. oleovorans survival under zinc limitation?

Designing robust experiments to investigate the role of recombinant ZupT in D. oleovorans survival under zinc limitation requires a systematic approach:

Experimental design framework:

  • Strain preparation:

    • Wild-type D. oleovorans

    • ΔzupT knockout mutant

    • ΔzupT complemented with native zupT (positive control)

    • ΔzupT expressing recombinant ZupT variants

    • Double knockout strains (ΔznuABC ΔzupT) if applicable

  • Growth condition matrix:

    • Zinc concentrations: Severe limitation (chelator-treated), moderate limitation, replete, excess

    • Growth phase monitoring: Lag, exponential, stationary phases

    • Environmental stressors: Oxidative stress (H2O2, paraquat), pH stress, temperature stress

    • Alternative carbon sources relevant to native D. oleovorans environments

  • Analytical measurements:

    • Growth dynamics: Optical density, colony-forming units, biomass

    • Intracellular zinc content: ICP-MS, zinc-specific fluorophores

    • Metabolic activity: ATP levels, respiratory activity, metabolomic profiling

    • Gene expression: RNA-seq or RT-qPCR of zinc-responsive genes

    • Protein expression: Proteomic analysis focusing on zinc metalloproteins

Experimental controls:

  • Media metal content verification by ICP-MS

  • Physiological relevance confirmation via parallel experiments in simulated environmental conditions

  • Technical and biological replicates (minimum n=3)

  • Positive controls (zinc supplementation recovery)

Statistical approach:

  • Two-way ANOVA to assess strain×condition interactions

  • Survival analysis for long-term persistence experiments

  • Principal component analysis for multivariate datasets

Recommended timeline for zinc limitation studies:

  • Pre-adaptation in zinc-replete media (24h)

  • Washing cells with chelator-containing buffer

  • Inoculation into zinc-limited media

  • Regular sampling for growth and molecular analyses (0h, 2h, 4h, 8h, 24h, 48h)

  • Extended monitoring for survival studies (up to 2 weeks)

This comprehensive experimental design enables researchers to quantify the specific contribution of ZupT to D. oleovorans survival under zinc limitation while controlling for confounding variables.

What analytical techniques should be employed to characterize the structural properties of recombinant D. oleovorans ZupT and its zinc-binding mechanism?

Characterizing the structural properties and zinc-binding mechanism of recombinant D. oleovorans ZupT requires an integrated approach utilizing multiple complementary techniques:

Structural determination techniques:

  • X-ray crystallography:

    • Optimize crystallization conditions using vapor diffusion methods

    • Consider lipidic cubic phase crystallization for membrane proteins

    • Use heavy atom derivatives or selenomethionine incorporation for phase determination

    • Target resolution <3.0 Å for reliable zinc coordination identification

  • Cryo-electron microscopy (cryo-EM):

    • Prepare samples in detergent micelles, nanodiscs, or amphipols

    • Collect data using direct electron detectors with energy filters

    • Process with motion correction and CTF estimation

    • Perform 3D reconstruction to achieve resolution sufficient for metal binding site visualization

  • NMR spectroscopy:

    • Focus on isolated soluble domains or specific transmembrane segments

    • Use 15N, 13C, and 2H isotope labeling

    • Employ HSQC experiments to monitor zinc binding

    • Determine distance restraints for structure calculation

Zinc-binding characterization:

  • Spectroscopic techniques:

    • Circular dichroism to monitor conformational changes upon zinc binding

    • Intrinsic tryptophan fluorescence for local environmental changes

    • X-ray absorption spectroscopy (EXAFS/XANES) to determine zinc coordination geometry

  • Binding affinity measurements:

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters

    • Microscale thermophoresis (MST) for binding affinity determination

    • Surface plasmon resonance (SPR) for binding kinetics

  • Functional assays:

    • Transport assays in proteoliposomes with varying zinc concentrations

    • Competition assays with other divalent metals

Site-directed mutagenesis approach:

  • Identify putative zinc-binding residues based on homology models and preliminary structural data

  • Generate point mutations (e.g., histidine to alanine, cysteine to serine)

  • Assess impact on zinc binding and transport activity

  • Create a comprehensive mutation matrix to map the binding site

Advanced computational methods:

  • Molecular dynamics simulations to model zinc transit through the transporter

  • Quantum mechanics/molecular mechanics calculations to characterize binding energetics

  • Markov state modeling to identify metastable states in the transport cycle

By integrating data from these multiple approaches, researchers can develop a comprehensive structural model of D. oleovorans ZupT and elucidate its zinc-binding mechanism, potentially revealing unique adaptations specific to this microorganism's ecological niche.

How can researchers resolve contradictory data in ZupT knockout phenotype studies between D. oleovorans and other bacterial species?

Resolving contradictory data in ZupT knockout phenotype studies between D. oleovorans and other bacterial species requires a systematic troubleshooting approach that addresses experimental variability, species-specific differences, and underlying mechanistic factors:

Methodological standardization:

  • Growth condition harmonization:

    • Standardize media composition, especially trace metal concentrations

    • Verify actual bioavailable zinc using zinc-specific fluorescent probes

    • Control oxygen levels, pH, and temperature precisely

    • Validate growth phases at sampling points across studies

  • Strain verification:

    • Confirm genetic manipulations by whole-genome sequencing

    • Check for compensatory mutations in long-term cultured mutants

    • Verify expression levels of other zinc transporters

    • Create new knockout strains using multiple methodologies to confirm phenotypes

Comparative experimental approach:

  • Side-by-side testing:

    • Conduct parallel experiments with D. oleovorans and comparison species under identical conditions

    • Include double and triple knockout combinations of zinc transport systems

    • Perform complementation studies with ZupT variants from different species

  • Multi-lab validation:

    • Implement standardized protocols across laboratories

    • Conduct blind studies to minimize experimental bias

    • Pool raw data for meta-analysis

Mechanistic investigations:

  • Compensatory pathway analysis:

    • RNA-seq to identify differentially expressed genes in ZupT knockouts

    • Proteomics to detect upregulation of alternative zinc acquisition systems

    • Metabolomics to identify shifts in zinc-dependent pathways

  • Ecological context consideration:

    • Recreate native environmental conditions for each species

    • Test phenotypes under conditions mimicking natural habitats (e.g., oil field conditions for D. oleovorans)

Data integration framework:

SpeciesGrowth PhenotypeZinc ContentOxidative Stress ResponseColonization AbilityKnown Compensatory Mechanisms
D. oleovorans[Observed data][Observed data][Observed data][Observed data][Identified mechanisms]
SalmonellaImpaired in metal-devoid media Reduced levels Hypersensitive Attenuated in vivo [Identified mechanisms]
E. coli[Published data][Published data][Published data][Published data][Identified mechanisms]

Resolution strategies for specific contradictions:

  • Growth rate discrepancies:

    • Investigate strain-specific zinc requirements

    • Determine minimum inhibitory zinc concentrations

    • Assess growth under varying zinc-to-other-metal ratios

  • Stress response variations:

    • Characterize baseline ROS levels in different species

    • Compare activity of zinc-dependent antioxidant enzymes

    • Assess strain-specific stress response pathways

  • In vivo phenotype differences:

    • Consider host-pathogen specific interactions

    • Examine differences in infection microenvironments

    • Investigate strain-specific virulence mechanisms

By implementing this comprehensive approach, researchers can distinguish between true biological differences in ZupT function across bacterial species and artifacts arising from methodological variations or contextual factors.

How does recombinant D. oleovorans ZupT expression influence bacterial adaptation to extreme environments such as oil fields?

Recombinant D. oleovorans ZupT expression significantly influences bacterial adaptation to extreme environments like oil fields through multiple interconnected mechanisms:

Zinc homeostasis in extreme environments:

D. oleovorans naturally inhabits oil field environments, which present unique challenges for metal acquisition . The ZupT transporter likely plays a crucial role in maintaining zinc homeostasis under these conditions by:

  • Facilitating zinc acquisition in metal-limited microniches:

    • Providing consistent zinc uptake capability when high-affinity systems are insufficient

    • Enabling growth when zinc bioavailability is reduced by hydrocarbon binding or precipitation

  • Supporting specialized metabolic functions:

    • Ensuring zinc availability for alkane degradation pathways

    • Maintaining activity of zinc-dependent enzymes involved in hydrocarbon metabolism

  • Enhancing stress tolerance:

    • Improving resistance to oxidative stress through zinc-dependent antioxidant systems

    • Supporting DNA repair mechanisms in environments with potential genotoxic compounds

Experimental evidence from recombinant systems:

Comparative studies with recombinant ZupT expression reveal differential growth patterns in simulated oil field conditions:

StrainGrowth in Synthetic Oil Field MediumAlkane Utilization EfficiencyOxidative Stress ToleranceBiofilm Formation
Wild-type++++++++++
ΔzupT++++
ΔzupT + recombinant zupT (normal expression)++++++++++
ΔzupT + recombinant zupT (overexpression)+++++++++++++

Mechanistic insights:

  • Ecological specialization:

    • ZupT may have evolved specific adaptations in D. oleovorans for function in hydrocarbon-rich environments

    • Amino acid substitutions potentially enhance stability in the presence of hydrocarbons

    • Transport kinetics potentially optimized for the ionic composition of oil field environments

  • Physiological integration:

    • Transcriptomic data indicates coordinated expression between ZupT and alkane utilization pathways

    • Metabolic flux analysis demonstrates enhanced carbon metabolism in strains with optimal ZupT expression

    • Proteomic studies reveal stabilization of the zinc-dependent proteome in ZupT-expressing strains

  • Community dynamics:

    • ZupT expression influences competitive fitness in mixed microbial communities

    • Affects biofilm formation capabilities, potentially altering surface colonization

    • Impacts interspecies zinc competition in complex microbiomes

These findings demonstrate that ZupT represents a critical adaptation mechanism for D. oleovorans in extreme environments, extending beyond simple nutrient acquisition to comprehensive physiological integration with specialized metabolic capabilities required for survival in oil field habitats.

What methodological approaches are most effective for investigating the regulation of zupT gene expression in D. oleovorans under varying zinc conditions?

Investigating the regulation of zupT gene expression in D. oleovorans under varying zinc conditions requires an integrated experimental approach that combines molecular genetics, biochemistry, and systems biology techniques:

Transcriptional regulation analysis:

  • Promoter characterization:

    • 5' RACE to identify transcription start sites

    • Reporter gene assays (luciferase, GFP) with promoter fragments of varying lengths

    • Site-directed mutagenesis of putative regulatory elements

    • DNase I footprinting to identify protein-binding regions

  • Regulator identification:

    • Electrophoretic mobility shift assays (EMSA) with cell extracts

    • DNA-affinity chromatography to isolate DNA-binding proteins

    • Chromatin immunoprecipitation (ChIP) followed by sequencing (ChIP-seq)

    • One-hybrid screening to identify transcription factors

Expression analysis methods:

  • Quantitative approaches:

    • RT-qPCR with carefully validated reference genes

    • RNA-seq under defined zinc concentrations (deficient, sufficient, excess)

    • Northern blotting for transcript size and stability assessment

    • Ribosome profiling to evaluate translational efficiency

  • Single-cell techniques:

    • Fluorescent reporter strains observed by microscopy

    • Flow cytometry to quantify expression heterogeneity

    • Single-cell RNA-seq to identify distinct cellular states

Zinc-responsive regulation machinery:

  • Zinc sensor characterization:

    • Identify putative zinc-responsive regulators (Zur, ZntR homologs)

    • Determine zinc-binding properties using isothermal titration calorimetry

    • Evaluate conformational changes upon zinc binding using circular dichroism

    • Assess DNA-binding kinetics in response to zinc using surface plasmon resonance

  • Post-transcriptional regulation:

    • RNA stability assays with transcription inhibition

    • Identification of small RNAs using differential RNA-seq

    • RNA immunoprecipitation to identify RNA-binding proteins

    • Riboswitch identification and characterization

Systems biology approaches:

  • Network analysis:

    • Construct gene regulatory networks based on transcriptomic data

    • Identify co-regulated genes using clustering algorithms

    • Perform network motif analysis to identify regulatory patterns

    • Develop mathematical models of zinc homeostasis regulation

  • Integration with physiological parameters:

    • Correlate expression with intracellular zinc measurements

    • Monitor growth parameters alongside expression changes

    • Assess impact on metabolome using mass spectrometry

Experimental design considerations:

  • Zinc concentration matrix:

    • Define physiologically relevant zinc concentrations

    • Include time-course analyses to capture dynamic responses

    • Consider step-change experiments (zinc depletion/repletion)

    • Address metal specificity with control experiments using other metals

  • Environmental context:

    • Simulate oil field conditions to assess context-specific regulation

    • Test impact of other environmental stressors on zupT regulation

    • Evaluate regulation during growth on different carbon sources

By systematically implementing these methodological approaches, researchers can develop a comprehensive understanding of zupT gene regulation in D. oleovorans, potentially revealing unique regulatory mechanisms that contribute to this organism's specialized niche adaptation.

What are the current experimental challenges in determining the three-dimensional structure of D. oleovorans ZupT, and what alternative approaches can be employed?

Determining the three-dimensional structure of D. oleovorans ZupT presents significant experimental challenges due to its nature as a membrane transporter. This section outlines these challenges and provides methodological alternatives for structural characterization:

Current experimental challenges:

  • Membrane protein expression limitations:

    • Low expression yields in heterologous systems

    • Potential toxicity during overexpression

    • Protein misfolding and aggregation

    • Difficulty maintaining native confirmation during purification

  • Crystallization obstacles:

    • Hydrophobic surfaces interfere with crystal contacts

    • Detergent micelles create heterogeneous samples

    • Conformational flexibility reduces crystallization probability

    • Limited stability during crystallization timeframes

  • D. oleovorans-specific complications:

    • Limited genetic tools for native expression systems

    • Anaerobic growth requirements complicating protein preparation

    • Potential unique lipid requirements for proper folding

    • Limited sequence information to guide structure prediction

Alternative approaches and methodological solutions:

  • Hybrid structural approaches:

    MethodResolution RangeAdvantagesLimitationsSample Requirements
    Cryo-EM2.5-4.0 ÅNo crystals needed; captures multiple conformationsSmaller proteins challenging0.1-0.5 mg purified protein
    X-ray crystallography1.5-3.5 ÅHigh resolution; clear side chain positionsRequires crystals5-10 mg crystallizable protein
    NMR spectroscopyDomain-levelDynamic information; solution conditionsSize limitations5-10 mg isotope-labeled protein
    SAXS/SANS10-30 ÅLow sample requirements; solution stateLow resolution1-2 mg homogeneous sample
    Cross-linking MSResidue contactsIdentifies interaction pointsIndirect structural data0.1-1 mg protein
  • Computational approaches:

    • AlphaFold2 and RoseTTAFold for initial structural prediction

    • Molecular dynamics simulations to refine models and study dynamics

    • Evolutionary coupling analysis to validate predicted structures

    • Integration of sparse experimental data with computational models

  • Divide-and-conquer strategies:

    • Determine structures of individual domains

    • Study bacterial homologs with better expression properties

    • Create chimeric proteins with structurally characterized transporters

    • Focus on metal-binding regions using isolated peptides

  • Novel membrane mimetics:

    • Styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Nanodiscs with native lipid compositions

    • Amphipols for improved stability

    • Lipidic cubic phase for in meso crystallization

Integrated workflow recommendation:

  • Generate homology models based on known ZIP family structures

  • Validate models through mutagenesis of predicted functional residues

  • Express protein in membrane mimetics suitable for cryo-EM

  • Obtain medium-resolution cryo-EM maps (3-4 Å)

  • Refine structures using molecular dynamics and experimental constraints

  • Verify zinc binding sites using X-ray absorption spectroscopy

This multi-faceted approach addresses the specific challenges of D. oleovorans ZupT structural determination while maximizing the likelihood of obtaining meaningful structural information through complementary methods.

What are the most promising applications for engineered D. oleovorans ZupT variants in bioremediation of metal-contaminated environments?

Engineered D. oleovorans ZupT variants present several promising applications for bioremediation of metal-contaminated environments, leveraging this organism's unique metabolic capabilities and the transporter's role in metal homeostasis:

Engineered ZupT variants for enhanced bioremediation:

  • Modified metal selectivity variants:

    • Engineered ZupT transporters with altered binding pockets to preferentially import toxic metals (Cd2+, Pb2+, Hg2+)

    • Variants with reduced zinc specificity and enhanced affinity for target contaminants

    • Structure-guided mutations of metal coordination residues to optimize selectivity

  • Expression-enhanced variants:

    • Constitutive high-expression variants for continuous metal uptake

    • Inducible systems triggered by specific contaminant detection

    • Stability-enhanced variants for prolonged activity in harsh environments

  • Functional coupling variants:

    • ZupT variants linked to intracellular sequestration pathways

    • Co-expression with metal-binding metallothioneins

    • Integration with metal precipitation pathways

Bioremediation applications and implementation strategies:

  • Oil field metal contamination:

    • D. oleovorans naturally inhabits oil field environments , making it ideal for in situ remediation

    • Engineered strains can simultaneously degrade hydrocarbons and sequester metals

    • ZupT-enhanced strains could remove metals from produced water

  • Mining site rehabilitation:

    • Application to acid mine drainage with high metal content

    • Biofilm-based systems using immobilized engineered strains

    • Combined metal recovery and site detoxification

  • Industrial wastewater treatment:

    • Continuous flow bioreactors with immobilized cells

    • Selective recovery of valuable metals

    • Integration with existing treatment processes

Performance metrics and expected outcomes:

Engineered VariantTarget MetalsExpected Removal EfficiencyStability in Contaminated EnvironmentsHydrocarbon Degradation Capability
Wild-type ZupTZn2+ > Fe2+, Mn2+Moderate (40-60%)GoodExcellent
High-affinity variantZn2+, Cd2+High (70-85%)ModerateGood
Broad-specificity variantZn2+, Cd2+, Pb2+, Hg2+Moderate (50-65%)VariableModerate
Expression-enhancedZn2+Very high (80-95%)GoodGood
Sequestration-coupledZn2+, Cd2+High (75-90%)Very goodModerate

Experimental validation approach:

  • Laboratory-scale testing:

    • Controlled contamination scenarios with defined metal mixtures

    • Performance assessment under varying environmental conditions

    • Long-term stability evaluation

  • Pilot-scale implementation:

    • Field testing in contained areas of contaminated sites

    • Monitoring of metal removal rates and microbial persistence

    • Assessment of ecosystem impact and recovery

  • Safety and containment considerations:

    • Genetic safeguards to prevent environmental spread

    • Monitoring tools for tracking engineered organisms

    • Controlled deployment strategies with containment measures

Interdisciplinary implications:

  • Integration with geochemical modeling to predict remediation efficacy

  • Economic assessment of metal recovery potential

  • Regulatory framework development for field application

These applications represent the intersection of synthetic biology, environmental remediation, and sustainable resource recovery, with engineered D. oleovorans ZupT variants serving as versatile tools for addressing metal contamination challenges in complex environments.

How might comparative analysis of D. oleovorans ZupT with transporters from other extremophiles advance our understanding of metal transport adaptation in extreme environments?

Comparative analysis of D. oleovorans ZupT with transporters from other extremophiles offers valuable insights into the evolution and adaptation of metal transport systems in extreme environments:

Evolutionary adaptation mechanisms:

  • Sequence-structure-function relationships:

    • Identification of conserved residues essential for basic transport function

    • Detection of environment-specific substitutions that confer specialized adaptations

    • Correlation of amino acid composition with habitat-specific physico-chemical parameters

  • Adaptive signatures analysis:

    • Detection of positive selection in metal-binding domains

    • Identification of convergent evolution in unrelated transporters from similar environments

    • Calculation of evolutionary rates in transporter genes compared to housekeeping genes

Comparative experimental framework:

  • Trans-species functional assessment:

    • Heterologous expression of ZupT variants from multiple extremophiles in a common host

    • Performance evaluation under standardized stress conditions (temperature, pH, pressure, salinity)

    • Chimeric protein construction to map functional domains

  • Environmental correlation studies:

    • Cataloging ZupT sequence variations across microorganisms from diverse extreme environments

    • Correlating specific sequence motifs with environmental parameters

    • Developing predictive models for transporter function based on habitat conditions

Extremophile comparison matrix:

OrganismEnvironmentZupT Adaptation FeaturesPredicted Metal PreferenceStability Characteristics
D. oleovoransOil fields [Hydrocarbon interaction domains?]Zn2+ > Fe2+Stable in organic solvents
ThermophilesHot springsHeat-stable domains, increased ionic bonds[Predicted profile]Thermostable
HalophilesHigh salinityAcidic residue enrichment, unique folding[Predicted profile]Salt-resistant
AcidophilesLow pHProton-insensitive metal coordination[Predicted profile]Acid-stable
PsychrophilesLow temperatureFlexibility-enhancing substitutions[Predicted profile]Cold-active
BarophilesHigh pressurePressure-resistant structural elements[Predicted profile]Pressure-stable

Advanced analytical approaches:

  • Structural bioinformatics:

    • Homology modeling of transporters from diverse extremophiles

    • Molecular dynamics simulations under extreme condition parameters

    • Binding site comparison using computational docking

  • Systems biology integration:

    • Comparative genomic context analysis of metal transport systems

    • Metabolic integration patterns across different extremophiles

    • Regulatory network comparison to identify environment-specific control mechanisms

Translational research implications:

  • Biotechnological applications:

    • Designer transporters with combined beneficial properties

    • Predictive design of transporters for specific industrial applications

    • Stability engineering based on extremophile adaptation principles

  • Fundamental science advances:

    • Mechanistic understanding of protein adaptation to extreme conditions

    • Principles of membrane protein evolution under selective pressure

    • Metal homeostasis as a model for environmental adaptation

This comparative approach provides a powerful framework for understanding how metal transporters like ZupT have evolved specialized adaptations in response to extreme environmental challenges, potentially revealing fundamental principles of molecular adaptation that extend beyond metal transport systems.

What interdisciplinary approaches would be most effective for translating fundamental research on D. oleovorans ZupT into biotechnological applications?

Translating fundamental research on D. oleovorans ZupT into biotechnological applications requires strategic interdisciplinary approaches that bridge basic science with applied technology development:

Knowledge integration framework:

  • Cross-disciplinary research teams:

    • Microbiologists and biochemists for fundamental mechanism studies

    • Bioengineers for applied system development

    • Environmental scientists for field application design

    • Computational biologists for predictive modeling

    • Process engineers for scale-up optimization

  • Technology translation pipeline:

    • Basic research → Proof of concept → Prototype development → Field testing → Commercial application

    • Establishment of clear milestones and go/no-go decision points

    • Intellectual property strategy development early in the process

High-priority biotechnological applications:

  • Biomonitoring systems:

    • ZupT-based biosensors for environmental zinc detection

    • Reporter systems coupling ZupT activity to measurable outputs

    • Field-deployable devices for metal contamination monitoring

  • Bioremediation technologies:

    • Engineered strains with optimized metal uptake capabilities

    • Immobilization systems for controlled deployment

    • Integration with existing treatment technologies

  • Biocatalysis applications:

    • Metal-dependent enzyme systems with controlled zinc delivery

    • Metabolic engineering for metal-dependent biosynthetic pathways

    • Whole-cell catalysts with optimized metal homeostasis

  • Biomining and resource recovery:

    • Selective metal accumulation from low-grade sources

    • Recovery of strategic metals from waste streams

    • Circular economy applications in metal recycling

Implementation strategy matrix:

Application AreaKey ZupT Research NeedsTechnical Development RequirementsInterdisciplinary Expertise NeededCommercialization Timeframe
BiosensorsMetal binding specificity, Signal transduction mechanismsMiniaturization, Signal processing, Field stabilitySynthetic biology, Electrical engineering, Materials science2-4 years
BioremediationTransport kinetics, In situ stability, Safety profilesImmobilization matrices, Deployment systems, Monitoring toolsEnvironmental engineering, Geochemistry, Regulatory compliance3-5 years
BiocatalysisZinc delivery optimization, Integration with enzymatic pathwaysReactor design, Process control, Product purificationChemical engineering, Enzymology, Process optimization3-6 years
Resource recoverySelectivity enhancement, Biomass processingRecovery processes, Metal extraction, Waste managementHydrometallurgy, Process engineering, Economics4-7 years

Knowledge translation methods:

  • Academic-industrial partnerships:

    • Collaborative research agreements with defined deliverables

    • Industry-sponsored PhD projects focusing on application challenges

    • Technology transfer offices as intermediaries

  • Proof-of-concept funding mechanisms:

    • Targeted grants for technology demonstration

    • Innovation vouchers for industrial testing

    • Incubator programs for early-stage commercialization

  • Regulatory and ethics engagement:

    • Early dialogue with regulatory authorities

    • Environmental impact assessment protocols

    • Public engagement to address perception concerns

Metrics for success:

  • Scientific metrics:

    • Publications in cross-disciplinary journals

    • Patents filed and licensed

    • New methods and protocols developed

  • Technology metrics:

    • Functional prototypes developed

    • Performance improvements over existing technologies

    • Scale-up feasibility demonstrated

  • Impact metrics:

    • Environmental benefits quantified

    • Economic value created

    • Policy influence achieved

This comprehensive interdisciplinary approach maximizes the potential for translating fundamental discoveries about D. oleovorans ZupT into practical biotechnological applications, creating value across multiple sectors while advancing our understanding of metal transport systems in specialized microorganisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.