Recombinant Desulforudis audaxviator ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Desulforudis audaxviator ATP synthase subunit b (atpF) is a genetically engineered version of the atpF subunit of the ATP synthase enzyme found in the bacterium Desulforudis audaxviator . ATP synthase is an essential enzyme that produces adenosine triphosphate (ATP), the primary energy currency of cells, by utilizing a proton gradient across a membrane . The atpF subunit is a component of the ATP synthase complex .

Desulforudis audaxviator

Desulforudis audaxviator is a sulfate-reducing bacterium (SRB) notable for its ability to thrive in extreme environments, such as deep underground locations, relying on sulfate reduction for energy production . SRBs play a vital role in anaerobic environments by mediating the reduction of sulfate to sulfide, thereby participating in the biogeochemical cycling of sulfur .

QmoABC Complex and DVU0851

The Qmo (quinone-interacting membrane-bound oxidoreductase) complex is crucial for transporting electrons to the dissimilatory adenosine-5'-phosphosulfate reductase in SRB . Studies involving Desulfovibrio vulgaris have shown that a deletion mutant lacking the qmoABC genes was unable to grow using sulfate as the sole electron acceptor . The DVU0851 protein, while not essential for sulfate reduction, may play a role in the efficiency of the process .

MazF Ribonuclease Activity

Candidatus Desulforudis audaxviator contains MazF toxins, and research has characterized MazF obtained from Candidatus Desulforudis audaxviator (MazF-Da) . MazF-Da is a ribonuclease that cleaves RNA sequences and exhibits the highest activity around 60°C . Specific amino acid residues, such as G18, E20, R25, and P26, are essential for its ribonuclease activity .

Role of ATP Synthase Subunit b (atpF)

FeatureDescription
FunctionPart of the ATP synthase complex, which is responsible for ATP production using a proton gradient .
ExpressionExpressed in E. coli .
Tag InformationThe tag type is determined during the production process .
StorageStore at -20°C, avoid repeated freeze-thaw cycles .
Storage BufferTris-based buffer with 50% glycerol, optimized for the protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please specify this in your order; we will prioritize its use.
Synonyms
atpF; Daud_2141; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Desulforudis audaxviator (strain MP104C)
Target Names
atpF
Target Protein Sequence
MVDLSFNATVFMQMFHFLLMLVVLRLFAYRPLMNVIEQRQAYIADEIEAAEKQKAAAAEL RSQLEADLAKAREEAKAIVARATKASDEQAQAIMEQARTEAQRLKEEALAEIGREREKAI AQLKDEVASLAVLVAAKVVKDGLTIDAQHNLVQNAIKEVGQLQ
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP in the presence of a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, linked by a central and peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk and connecting F(1) to F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Desulforudis audaxviator and why is its ATP synthase of research interest?

Candidatus Desulforudis audaxviator is a remarkable deep subsurface microorganism first discovered at 2.8 km depth in a South African gold mine, where it comprises >99.9% of the microorganisms inhabiting the fluid phase of particular fractures, effectively representing a "single species ecosystem" . This bacterium is a motile, sporulating, sulfate-reducing, chemoautotrophic thermophile capable of fixing its own nitrogen and carbon . Recent research has also identified its dominance in a 975 m deep groundwater-bearing fracture .

The ATP synthase of D. audaxviator is particularly interesting because it functions in an environment with unique energy constraints. Unlike surface organisms that depend on photosynthesis-derived energy, D. audaxviator utilizes energy from radiolysis induced by uranium, thorium, and potassium in surrounding rocks . The ATP synthase plays a critical role in this extreme environment by harnessing the proton gradient to generate ATP, making it essential to understanding how this organism thrives in isolation from photosynthetic energy sources.

How does the atpF subunit function within the ATP synthase complex?

The atpF gene encodes ATP synthase subunit b, a critical component of the F0 sector of F1F0-ATP synthase. This enzyme produces ATP from ADP in the presence of a proton or sodium gradient . The complete F-type ATP synthase consists of two structural domains:

  • F1 - containing the extramembraneous catalytic core

  • F0 - containing the membrane proton channel (which includes the b subunit)

These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation .

Specifically, the b subunit is part of the stator assembly that helps anchor the catalytic F1 portion to the membrane-embedded F0 portion. It functions as part of the "stator stalk" that prevents the F1 portion from rotating with the central rotor during ATP synthesis. This structural role is critical because it enables the enzyme to convert the energy from proton translocation into the mechanical energy needed for ATP synthesis.

What expression systems are commonly used for recombinant atpF production?

Various expression systems are used to produce recombinant atpF protein for research purposes, each with specific advantages depending on research objectives:

Expression SystemAdvantagesCommon ApplicationsReference
E. coliHigh yield, cost-effective, rapid expression, well-established protocolsStructural studies, antibody production, in vitro functional assays
Mammalian cellsProper post-translational modifications, suitable for interaction studies with mammalian proteinsComplex interaction studies, functional analyses requiring specific modifications
Insect cellsIntermediate between bacterial and mammalian systems, good for complex proteinsStructural studies requiring some eukaryotic-like modifications
YeastPost-translational modifications, high yieldStudies requiring eukaryotic-like processing

Selection factors include: required protein purity (ranging from >80% to >95%), fusion tag requirements (His, FLAG, MBP, GST, trxA, Nus, Biotin, GFP), experimental needs, and downstream applications .

When studying D. audaxviator atpF specifically, researchers must consider its origin from a thermophilic, anaerobic environment when choosing expression conditions to maintain proper folding and functionality.

What are the key structural features of atpF protein in D. audaxviator?

The atpF protein in D. audaxviator is a transmembrane protein with several key structural features that contribute to its function in ATP synthesis. According to available data , the protein contains:

  • Transmembrane helical domains - typically two transmembrane spanning regions that anchor the protein in the membrane

  • A cytoplasmic domain - extending into the bacterial cytoplasm that interacts with other components of the ATP synthase complex

  • Conserved residues - important for interaction with other subunits of the F0 sector and the peripheral stalk

When working with the recombinant protein, researchers should note that repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for up to one week to maintain structural integrity .

How does atpF contribute to D. audaxviator's ability to survive in extreme environments?

D. audaxviator thrives in extreme conditions where few other organisms can survive. The atpF subunit plays several critical roles in this adaptation:

  • Energy efficiency: In energy-limited environments, ATP synthase must operate with maximum efficiency. The b subunit (atpF) is crucial for maintaining the structural integrity of the complex during operation, ensuring efficient coupling between proton translocation and ATP synthesis even at low energy availability.

  • Thermostability: Living in environments with temperatures ranging from moderate to relatively high, D. audaxviator's ATP synthase components, including atpF, likely possess thermostable properties that maintain functionality across this temperature range.

  • Radiation resistance: D. audaxviator utilizes energy from radiation-induced radiolysis, with measured radiation dosages of 4.25 × 10⁵ to 8.52 × 10⁵ eV g⁻¹ s⁻¹ for alpha particles . The ATP synthase must function reliably despite potential radiation damage to cellular components.

  • Integration with unique energy sources: Unlike photosynthetic or common heterotrophic organisms, D. audaxviator harnesses energy primarily through sulfate reduction and the Wood-Ljungdahl pathway. The ATP synthase must efficiently utilize the proton gradient generated through these pathways in the absence of oxygen as a terminal electron acceptor .

Single-cell respiration rate studies have measured environmental sulfate reduction rates at 0.14 to 26.9 fmol cell⁻¹h⁻¹ for D. audaxviator . This suggests that the ATP synthase, including the atpF component, must be highly efficient at harvesting energy from minimal proton gradients to support this level of metabolic activity.

What methodologies are most effective for studying recombinant D. audaxviator atpF functionality?

Research on D. audaxviator atpF functionality requires specialized approaches due to the unique properties of this protein and its native environment:

1. In vitro reconstitution systems:

  • Liposome reconstitution with purified components to measure ATP synthesis rates

  • Proteoliposomes with co-reconstituted electron transport components to mimic natural conditions

  • Artificial membrane systems with controlled proton gradients

2. Biophysical characterization techniques:

  • Circular dichroism (CD) spectroscopy to assess secondary structure stability under different conditions (temperature, pH, radiation exposure)

  • Differential scanning calorimetry to determine thermostability profiles

  • Fluorescence resonance energy transfer (FRET) to study subunit interactions within the ATP synthase complex

3. Functional assays:

  • ATP synthesis assays under varying conditions (pH, temperature, pressure)

  • Proton pumping assays using pH-sensitive fluorescent dyes

  • Inhibitor studies to identify unique characteristics compared to other bacterial ATP synthases

4. Comparative studies:
When studying D. audaxviator atpF, comparative analysis with other bacterial ATP synthases is valuable. The study by Lin et al. on F1F0-ATP synthases of alkaliphilic bacteria provides methodological approaches that can be adapted for D. audaxviator research, particularly regarding proton path analysis and ion coupling mechanisms.

To effectively characterize D. audaxviator atpF, researchers should consider replicating deep subsurface conditions, including:

  • Anaerobic environment

  • Elevated pressures (~30 MPa, equivalent to ~3 km depth)

  • Temperatures typical of deep subsurface (30-60°C)

  • Radiation exposure to mimic natural radiolysis conditions

How does the atpF gene in D. audaxviator differ from other bacterial homologs?

Genomic and structural analysis reveals several distinctive features of D. audaxviator atpF compared to other bacterial homologs:

ATP Synthase ComponentTypical Bacterial FeatureD. audaxviator Adaptation
b subunit (atpF)Standard 2-helix hairpin structurePotentially modified hydrophobic regions for stability in high-pressure environments
ATP synthase complex organizationc-rotor with 10-15 c-subunitsUnknown stoichiometry, potentially optimized for energy efficiency
Regulatory elementsStandard bacterial promotersMay contain specialized elements for expression in energy-limited conditions

Sequence analysis of various ATP synthase components across different bacteria has shown that the number of c-subunits per c-rotor varies from 10-15 depending on the organism . The specific stoichiometry in D. audaxviator has not been definitively established but could represent an adaptation to its energy-limited environment.

How can recombinant atpF be used to study the bioenergetics of subsurface microbial communities?

Recombinant atpF from D. audaxviator provides a valuable tool for investigating the bioenergetics of deep subsurface microbial communities:

Experimental design for such studies should include:

  • Controls with well-characterized ATP synthase components from model organisms

  • Gradient analysis of function across varying conditions (temperature, pressure, pH)

  • Integration with other components of energy metabolism pathways

  • Analysis of atpF expression levels under simulated environmental conditions

These approaches can provide crucial insights into how subsurface microorganisms like D. audaxviator maintain energy metabolism in one of Earth's most extreme and energy-limited environments.

What are the optimal storage and handling conditions for recombinant D. audaxviator atpF?

Proper storage and handling of recombinant D. audaxviator atpF is critical for maintaining its structural integrity and functional activity:

Storage recommendations:

  • Store lyophilized protein at -20°C/-80°C; shelf life is typically 12 months in this form

  • For liquid formulations, store at -20°C/-80°C; shelf life is approximately 6 months

  • Avoid repeated freeze-thaw cycles as they can damage protein structure

  • Store working aliquots at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge vials prior to opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • Aliquot to minimize freeze-thaw cycles

Buffer considerations:

  • Tris/PBS-based buffers at pH 8.0 are commonly used

  • Addition of 6% trehalose can improve stability

  • For functional studies, buffer composition may need to be optimized to mirror the ionic conditions of the deep subsurface environment

Given D. audaxviator's native environment, researchers might consider including stabilizing agents that mimic aspects of the deep subsurface, such as elevated pressure during functional studies or specific metal ions that may be cofactors in the native system.

What quality control measures should be implemented when working with recombinant atpF?

To ensure reliable experimental results, several quality control measures should be implemented when working with recombinant D. audaxviator atpF:

  • Purity assessment:

    • SDS-PAGE analysis (minimum acceptable purity typically >85%)

    • Mass spectrometry to confirm protein identity and detect potential contaminants

    • Size exclusion chromatography to assess aggregation state

  • Functional validation:

    • ATPase activity assays to confirm enzymatic function

    • Binding assays with other ATP synthase subunits to verify interaction capacity

    • Circular dichroism to confirm proper folding and secondary structure

  • Stability monitoring:

    • Thermal shift assays to assess protein stability under varying conditions

    • Long-term stability tests at different storage temperatures

    • Activity measurements before and after storage periods

  • Batch consistency:

    • Comparison of physical and functional properties between different production batches

    • Standardized production protocols to minimize batch-to-batch variation

    • Reference standards for comparative analysis

  • Contamination checks:

    • Endotoxin testing for proteins expressed in bacterial systems

    • Microbial contamination testing for long-term stored samples

    • Host cell protein analysis to identify potential contaminants from the expression system

These quality control measures are particularly important for D. audaxviator atpF given its origin from an extremophile and its anticipated use in specialized research applications requiring high reproducibility.

How can site-directed mutagenesis of recombinant atpF help understand its role in proton translocation?

Site-directed mutagenesis of recombinant D. audaxviator atpF provides a powerful approach to understanding its specific role in proton translocation and energy conservation:

  • Targeted mutation strategies:

    • Mutations of conserved residues in transmembrane regions can identify amino acids essential for proton channel formation

    • Alterations to residues at the interface with other F0 subunits can reveal critical interaction sites

    • Introduction of reporter groups (e.g., fluorescent residues) at strategic positions can enable real-time monitoring of conformational changes during activity

  • Key residues to target:

    • Based on studies of ATP synthases from other organisms, the essential arginine residue in subunit a that interacts with c-subunit carboxylates is critical for proton translocation

    • Residues in the b subunit that form the peripheral stalk and maintain structural integrity during rotation

    • Amino acids involved in interactions with the F1 sector that may be unique to D. audaxviator

  • Functional assays for mutant analysis:

    • Proton pumping assays using pH-sensitive dyes in reconstituted liposomes

    • ATP synthesis/hydrolysis rates under varying conditions

    • Structural stability assessments under pressure and temperature conditions mimicking the deep subsurface

  • Comparative analysis framework:
    The F1F0 ATP synthase mechanism involves:

    • Proton uptake from the P-side of the membrane mediated by the a-subunit

    • Binding of protons to successive c-subunits at the a/c interface

    • Rotation of the c-ring causing conformational changes in the F1 sector

    • ATP synthesis through the binding change mechanism

    Mutations in atpF can help determine how this subunit contributes to maintaining the structural framework necessary for this process.

By systematically mutating specific residues and measuring the resulting changes in ATP synthase function, researchers can develop a detailed model of how D. audaxviator atpF contributes to energy conservation in extreme environments, potentially revealing unique adaptations that could inspire biotechnological applications.

How can studies of D. audaxviator atpF inform astrobiology and the search for life in extreme environments?

D. audaxviator's ability to thrive in isolated deep subsurface environments makes it an excellent model organism for astrobiological studies. Research on its atpF and ATP synthase has several implications for the search for life beyond Earth:

  • Biosignature development:

    • Understanding the specific adaptations in D. audaxviator atpF can help identify potential biosignatures to look for in samples from Mars, Europa, or other potentially habitable environments

    • The ATP synthase complex represents a fundamental component of cellular energy metabolism that would likely be present in any life form based on similar biochemical principles

  • Habitability assessment:

    • D. audaxviator demonstrates that life can exist in radiation-rich, anoxic subsurface environments similar to those that might exist on Mars or Europa

    • Studies of how its ATP synthase functions under extreme conditions can help refine our understanding of the physical and chemical limits of habitability

  • Extraterrestrial analog environments:
    Research on D. audaxviator suggests that:

    • Subsurface environments on Mars could potentially harbor similar organisms capable of utilizing radiolysis-generated hydrogen

    • Europa's subsurface ocean, influenced by radiation from Jupiter, might provide energy sources analogous to those used by D. audaxviator

    • Enceladus's hydrothermal systems could support organisms with similar metabolic strategies

  • Evolutionary implications:

    • D. audaxviator's acquisition of genes through horizontal gene transfer, including some typically found in archaea , provides insights into how life might adapt to extreme isolation

    • The Wood-Ljungdahl pathway used by D. audaxviator is considered one of the earliest carbon fixation pathways, potentially reflecting early Earth conditions and early life

As noted by Chivian et al., D. audaxviator represents "an example of a natural ecosystem that appears to have its biological component entirely encoded within a single genome" . This extreme reduction in community complexity makes it a valuable model for understanding the minimal requirements for life in extreme environments, with direct implications for astrobiology.

What are the potential applications of recombinant atpF in biotechnology and bioenergy research?

Recombinant atpF from D. audaxviator offers several promising applications in biotechnology and bioenergy research:

  • Thermostable ATP synthase components:

    • D. audaxviator's adaptations to deep subsurface conditions may yield thermostable ATP synthase components with applications in biotechnological processes requiring elevated temperatures

    • Recombinant atpF could be incorporated into hybrid ATP synthases with enhanced stability and efficiency

  • Bioenergy applications:

    • Understanding how D. audaxviator's ATP synthase operates efficiently under energy-limited conditions could inform the development of improved bioenergy systems

    • The Wood-Ljungdahl pathway coupled with ATP synthesis represents a model for carbon-neutral energy generation that could inspire synthetic biology approaches

  • Radiation-resistant biotechnology:

    • D. audaxviator's adaptations to radiation exposure could lead to the development of radiation-resistant biocatalysts for use in remediation of radioactive waste or other applications requiring radiation tolerance

    • Recombinant atpF could be studied to understand how protein structure and function are maintained under radiation stress

  • Deep subsurface bioremediation:

    • Understanding D. audaxviator's metabolic capabilities, including its ATP synthase function, could inform strategies for bioremediation of contaminated deep subsurface environments

    • Engineered organisms incorporating radiation-resistant ATP synthase components could potentially be developed for specialized remediation applications

  • Biosensors for extreme environments:

    • Components of D. audaxviator's ATP synthase could be incorporated into biosensors designed to function in extreme environments, such as high temperature, high pressure, or radiation-exposed settings

    • Such biosensors could monitor environmental conditions or detect specific compounds in otherwise inaccessible environments

The unique adaptations of D. audaxviator's ATP synthase to function efficiently in energy-limited, extreme environments make it a valuable subject for biomimetic approaches in sustainable energy and biotechnology applications.

What emerging technologies could enhance the study of atpF structure and function?

Several emerging technologies hold promise for advancing our understanding of D. audaxviator atpF structure and function:

  • Cryo-electron microscopy (cryo-EM):

    • Recent advances in cryo-EM allow determination of protein structures at near-atomic resolution without the need for crystallization

    • This approach could reveal the detailed structure of D. audaxviator's ATP synthase, including the arrangement of the atpF subunit within the complex

    • Time-resolved cryo-EM could potentially capture different conformational states during the catalytic cycle

  • Single-molecule techniques:

    • Single-molecule FRET (smFRET) can monitor conformational changes in real-time

    • Optical tweezers can measure forces generated during ATP synthase operation

    • These approaches could provide insights into how D. audaxviator's ATP synthase functions at the molecular level

  • Advanced computational methods:

    • Molecular dynamics simulations incorporating high-pressure conditions could model atpF behavior in the deep subsurface

    • Machine learning approaches could identify subtle structural adaptations by comparing sequences across diverse extremophiles

    • Quantum mechanics/molecular mechanics (QM/MM) calculations could model proton transfer events in the ATP synthase complex

  • Microfluidic devices:

    • Microfluidic systems can recreate environmental gradients mimicking those in the deep subsurface

    • These platforms could allow real-time monitoring of ATP synthase activity under varying conditions

    • Droplet-based microfluidics could enable high-throughput screening of mutant atpF variants

  • In situ techniques for environmental samples:

    • RedoxSensor™ Green has been used to measure rates of anaerobic electron transfer physiology in individual cells and link those measurements to genomic sequencing of the same single cells

    • Similar approaches could be developed specifically for ATP synthase activity

    • These methods could bridge laboratory studies with environmental observations

These emerging technologies, combined with traditional biochemical and biophysical methods, will provide a more comprehensive understanding of how D. audaxviator's ATP synthase functions in its extreme environment and how it differs from better-studied model systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.