Recombinant Desulforudis audaxviator Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction

Glycerol-3-phosphate acyltransferase (PlsY) is an enzyme involved in phospholipid biosynthesis. Desulforudis audaxviator is a bacterium found in extreme environments . Recombinant PlsY refers to the PlsY enzyme produced using recombinant DNA technology, where the gene encoding the enzyme is expressed in a host organism .

Function and Role

PlsY is an acyltransferase that catalyzes the acylation of glycerol-3-phosphate, which is a crucial step in the synthesis of phospholipids . Phospholipids are essential components of cell membranes, and their synthesis is vital for cell growth and survival . In Desulforudis audaxviator, PlsY likely plays a role in adapting to the extreme conditions of its habitat by modifying the lipid composition of its membranes .

Microbial Activity and Genetic Code

Candidatus Desulforudis audaxviator is known to be the most abundant and active microbe by reducing sulfate for energy . Researchers have been refining methods to measure the activity level of microbes and link it to their individual genetic code .

QmoABC Complex and Sulfate Reduction

The Qmo (quinone-interacting membrane-bound oxidoreductase) complex is responsible for transporting electrons to the dissimilatory adenosine-5′-phosphosulfate reductase in sulfate-reducing bacteria . A study showed that the Qmo complex is essential for sulfate respiration in D. vulgaris . Further experiments can determine whether all components of the Qmo complex are required for electron transfer or if individual components can function independently .

DVU0851 Protein in Sulfate Reduction

DVU0851 is a hypothetical protein whose role in sulfate reduction has been explored . A mutant lacking only DVU0851 was fully capable of growth by sulfate respiration, suggesting that DVU0851 is not essential for this process .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
plsY; Daud_1171; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Desulforudis audaxviator (strain MP104C)
Target Names
plsY
Target Protein Sequence
MSALAVILVIGLSYLVGSVPTGYLIARHVKGIDIRGHGSGNIGATNVWRTLGPGWGLASL VGDTAKGIVAVLLGRAVGVPGLELLTGAAALTGHGWSVFLRFQGGKIIATSLGVLIMLPP VALATAAAVWIAVLALTRYVSLASIIAASSVPLAFALGGVGWRHVLFGLFLALVAVYKHR ANIDRLLKGKESRFSFRK
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How can Design of Experiments (DoE) methodology be applied to optimize expression of recombinant Desulforudis audaxviator plsY?

Design of Experiments (DoE) offers significant advantages over traditional one-factor-at-a-time approaches for optimizing recombinant protein expression. For Desulforudis audaxviator plsY, a multivariate experimental design would be particularly valuable, as proteins from extremophiles often require specialized conditions for optimal expression .

Key principles of DoE for recombinant protein optimization:

  • Variable identification: For Desulforudis audaxviator plsY expression, consider these critical variables:

    • Temperature (particularly important for proteins from thermophiles)

    • Induction time (4-6 hours has shown good results for other proteins)

    • Inducer concentration

    • Media composition (especially carbon source and metal ions)

    • Presence of chaperones or folding assistants

    • Cell density at induction

  • Experimental design selection: For initial screening, a fractional factorial design (2^8-4) with 8 variables at 2 levels plus center point replicates is recommended to minimize experiments while maintaining statistical validity .

Practical DoE implementation example:

VariableLow level (-1)Center (0)High level (+1)
Temperature25°C30°C37°C
IPTG concentration0.1 mM0.5 mM1.0 mM
Post-induction time4 h8 h16 h
MediaLBTB2×YT
OD600 at induction0.40.71.0
pH6.87.27.6
Glycerol0%1%2%
Salt (NaCl)5 g/L10 g/L15 g/L

The response variables should include:

  • Protein yield (mg/L)

  • Soluble fraction percentage

  • Enzymatic activity

  • Protein purity

Statistical analysis of results would identify significant variables and their interactions, guiding further optimization using response surface methodology (RSM) .

This approach has demonstrated success in other recombinant protein systems, achieving up to 250 mg/L of soluble functional protein with 75% homogeneity .

  • What structural-functional relationship insights might be gained from studying Desulforudis audaxviator plsY?

  • Sequence-based analysis:

    • The hydrophobicity profile of the amino acid sequence (MSALAVILVIGLSYLVGSVPTG...) suggests multiple transmembrane regions, consistent with membrane association expected for phospholipid biosynthesis enzymes .

    • Comparative analysis with mesophilic plsY homologs could identify signatures of thermoadaptation, such as increased arginine and lysine content, decreased asparagine and glutamine, and preference for hydrophobic residues in the core.

  • Structural considerations:

    • The protein likely adopts a structure that maintains stability and activity under the conditions found in deep subsurface environments (elevated temperatures, possibly high pressure).

    • X-ray crystallography or cryo-EM studies could reveal structural features that contribute to thermostability.

    • Molecular dynamics simulations could predict how the enzyme functions under different environmental conditions.

  • Functional analysis:

    • Investigation of substrate specificity might reveal adaptations to the lipid composition required for membrane function in extreme environments.

    • Temperature-activity profiles could demonstrate adaptation to Desulforudis audaxviator's thermal niche.

    • Pressure effects on enzyme activity would be particularly relevant given the organism's deep subsurface habitat.

Such studies could provide insights into:

  • Evolutionary adaptations to extreme environments

  • Structure-based design of enzymes with enhanced stability

  • Understanding of lipid metabolism in extremophiles

  • Mechanisms of protein adaptation to energy-limited environments

  • How do the ecological adaptations of Desulforudis audaxviator potentially influence its plsY enzyme characteristics?

Desulforudis audaxviator's ecological adaptations likely have profound effects on its plsY enzyme characteristics, reflecting the organism's remarkable ability to thrive in deep subsurface environments. These potential influences include:

  • Adaptations to energy limitation:

    • Desulforudis audaxviator inhabits extremely low-energy environments and has evolved efficient energy utilization strategies .

    • The plsY enzyme may exhibit unusually high catalytic efficiency to minimize energy expenditure.

    • Kinetic parameters potentially favor high substrate affinity (low Km) over high turnover (kcat) to function effectively with limited substrates.

  • Thermal adaptations:

    • As a thermophile, Desulforudis audaxviator's plsY likely exhibits thermostability mechanisms.

    • The enzyme may contain increased hydrophobic interactions, additional salt bridges, and reduced surface loops compared to mesophilic homologs.

    • Activity optima likely correspond to the organism's growth temperature (around 60°C based on enzyme activity studies of other proteins) .

  • Membrane composition adaptations:

    • Deep subsurface environments exert pressure and temperature stresses requiring specialized membrane compositions.

    • The plsY enzyme may have evolved substrate preferences reflecting the need for specific phospholipids that maintain membrane fluidity and integrity under these conditions.

    • Substrate specificity might favor precursors that lead to branched-chain fatty acids or other modifications that enhance membrane stability.

  • Oxygen sensitivity considerations:

    • As an anaerobe, Desulforudis audaxviator's proteins may be sensitive to oxidation.

    • The plsY enzyme might contain oxygen-sensitive residues requiring reducing conditions for activity assays.

    • Expression and purification may require anaerobic conditions for optimal activity retention.

Experimental approaches to investigate these adaptations would include comparative enzymatic assays across temperature, pressure, and substrate ranges, combined with structural studies to identify the molecular basis of these adaptations.

  • What are the most effective experimental design approaches for assessing the enzymatic activity of recombinant Desulforudis audaxviator plsY?

Assessing the enzymatic activity of recombinant Desulforudis audaxviator plsY requires carefully designed experimental approaches that account for the protein's biochemical function and the organism's native environment. The following methodology is recommended:

1. Activity assay design:

A coupled enzymatic assay is recommended to measure the acyltransferase activity of plsY:

Primary reaction:

  • Acyl-phosphate + Glycerol-3-phosphate → Lysophosphatidic acid + Phosphate

Detection methods:

  • Direct: Monitor phosphate release using malachite green or similar phosphate detection reagents

  • Coupled: Link to ADP production and subsequent NADH oxidation for spectrophotometric monitoring

  • Radiochemical: Use 14C-labeled substrates to track product formation

2. Optimization of assay conditions:

ParameterRange to testConsiderations
Temperature30-80°CInclude 60°C based on optimal activity of other D. audaxviator enzymes
pH6.0-9.0Test in 0.5 unit increments
Buffer systemHEPES, Tris, PhosphateAvoid buffers with inhibitory metal binding
Divalent cationsMg2+, Mn2+, Ca2+ (0-10 mM)Essential for many acyltransferases
Reducing agentsDTT, 2-mercaptoethanol (0-10 mM)Important for maintaining anaerobic enzyme activity
Substrate concentration0.01-1.0 mMFor Km determination

3. Controls and validations:

  • Negative controls: Heat-inactivated enzyme, reaction missing one substrate

  • Positive controls: Commercial acyltransferases with similar function

  • Substrate specificity: Test various acyl-phosphate donors and glycerol-phosphate acceptors

  • Inhibition studies: Test product inhibition and specific inhibitors

  • Mass spectrometry validation: Confirm product identity

4. Specialized considerations for extremophilic enzymes:

  • Temperature stability: Pre-incubate enzyme at various temperatures before assaying

  • Pressure effects: Consider using pressure chambers for activity assessment

  • Anaerobic conditions: Perform assays in an anaerobic chamber or using oxygen-scavenging systems

  • Halotolerance: Test activity across salt concentration gradient

5. Data analysis approach:

  • Determine kinetic parameters (Km, Vmax, kcat, kcat/Km) for comparison with homologous enzymes

  • Apply non-linear regression for accurate parameter estimation

  • Use appropriate statistical tests to validate significance of differences

This comprehensive approach will provide robust assessment of the enzymatic properties of recombinant Desulforudis audaxviator plsY while accounting for its extremophilic origin.

  • How can site-directed mutagenesis be used to investigate substrate specificity and catalytic mechanism of Desulforudis audaxviator plsY?

Site-directed mutagenesis represents a powerful approach to investigate the substrate specificity and catalytic mechanism of Desulforudis audaxviator plsY. This methodology can be particularly informative for understanding how this enzyme functions in its extreme environment.

Identification of target residues for mutagenesis:

  • Sequence alignment-based targets:

    • Align Desulforudis audaxviator plsY with characterized plsY enzymes from model organisms

    • Identify conserved residues likely involved in catalysis or substrate binding

    • Identify unique residues that may contribute to extremophilic adaptations

  • Structure-based targets:

    • If a crystal structure is available, identify active site residues

    • If not, use homology modeling based on related structures

    • Focus on residues lining substrate binding pockets and catalytic sites

Mutagenesis strategy:

Mutation typeTarget residuesPurpose
Alanine scanningConserved polar/charged residuesIdentify catalytically essential residues
Conservative substitutionsCatalytic residuesDistinguish roles in binding vs. catalysis
Non-conservative substitutionsSubstrate binding pocketAlter substrate specificity
Domain swappingSubstrate recognition domainsTransfer specificity from other homologs
Thermostability mutationsSurface exposed residuesUnderstand thermoadaptation

Experimental design framework:

  • Generate mutant libraries:

    • Use PCR-based site-directed mutagenesis methods

    • Create single mutants first, then combine beneficial mutations

    • Include controls for expression verification

  • Expression and purification:

    • Express mutants under identical conditions to wild-type

    • Verify proper folding using circular dichroism or fluorescence spectroscopy

    • Quantify protein to ensure equal amounts in activity comparisons

  • Activity characterization:

    • Determine kinetic parameters for each mutant

    • Compare substrate scope using various acyl donors

    • Test temperature and pH profiles

  • Structural validation:

    • Obtain crystal structures of key mutants if possible

    • Use hydrogen-deuterium exchange mass spectrometry to probe structural changes

    • Apply molecular dynamics simulations to predict effects

This approach would be similar to successful studies conducted with MazF from Desulforudis audaxviator, where site-directed mutagenesis of conserved residues (G18, E20, R25, P26, and N36) revealed their importance for ribonuclease activity and substrate recognition .

  • What regulatory and biosafety considerations apply to research with recombinant Desulforudis audaxviator plsY under NIH Guidelines?

Research involving recombinant Desulforudis audaxviator plsY must comply with the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, which specify biosafety practices and containment principles. The following considerations apply:

1. Scope and applicability:

The NIH Guidelines apply to:

  • Research conducted at or sponsored by institutions receiving NIH support for recombinant DNA research

  • Research involving testing in humans of materials containing recombinant DNA developed with NIH funds

  • All recombinant DNA research performed abroad that is supported by NIH funds

2. Classification of experiments:

Recombinant Desulforudis audaxviator plsY research would typically fall under:

  • Section III-E: Experiments that require IBC notice at the time of initiation

  • Specifically, Section III-E-1: Experiments involving the formation of recombinant or synthetic DNA molecules containing no more than two-thirds of the genome of any eukaryotic virus

3. Required approvals:

AuthorityWhen requiredTimeline
Institutional Biosafety Committee (IBC)Prior to initiationTypically 1-2 months
NIH Office of Science Policy (OSP)Only if experiments fall under Sections III-A, III-B, or III-CNot typically required for plsY research
Institutional Review Board (IRB)Only if human subjects involvedNot applicable for basic research

4. Containment level determination:

For Desulforudis audaxviator plsY expressed in E. coli K-12 derivatives:

  • Biosafety Level 1 (BSL-1) is typically sufficient

  • Risk assessment should consider:

    • Desulforudis audaxviator is not a known pathogen

    • plsY protein is not associated with virulence or toxicity

    • The recombinant protein is unlikely to confer harmful properties

5. Documentation requirements:

  • Maintain records of IBC approvals

  • Document risk assessment

  • Keep detailed protocols for safe handling

  • Maintain training records for laboratory personnel

6. Special considerations for extremophile proteins:

  • While not explicitly addressed in NIH Guidelines, institutional policies may require additional documentation for extremophile-derived proteins

  • Consider ecological impact if the protein confers selective advantages to the expression host

7. International considerations:

If conducting research abroad:

  • Comply with host country regulations

  • If no host country rules exist, obtain NIH-approved IBC review and approval from appropriate national authority

  • Ensure safety practices are reasonably consistent with NIH Guidelines

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.