Recombinant Desulfotalea psychrophila Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Desulfotalea psychrophila Lipid A Export ATP-Binding/Permease Protein MsbA (msbA)

The recombinant Desulfotalea psychrophila Lipid A export ATP-binding/permease protein MsbA (msbA) is a membrane-bound ATP-binding cassette (ABC) transporter critical for bacterial membrane biogenesis. This protein facilitates the translocation of lipid A, a core component of lipopolysaccharide (LPS), from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane in Gram-negative bacteria .

Key Properties

PropertyDetail
Source OrganismDesulfotalea psychrophila (strain LSv54 / DSM 12343)
UniProt IDQ6AJW3
Protein Length572 amino acids
Expression SystemE. coli
TagDetermined during production (e.g., His-tag in homologs)
Storage BufferTris-based buffer, 50% glycerol, optimized for stability
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles

Mechanism of Action

  1. Lipid A Flippase Activity: MsbA binds lipid A via hydrophobic interactions and uses ATP hydrolysis to drive its translocation across the inner membrane .

  2. Periplasmic Modification: In Francisella novicida, MsbA-dependent export enables lipid A 1-dephosphorylation by FnLpxE, an enzyme active on the periplasmic face .

  3. Structural Evidence: X-ray crystallography of Salmonella MsbA revealed a large transmembrane portal and lipid A density in the cavity, supporting a "trap-and-flip" model .

Recombinant Production and Characterization

Recombinant MsbA is typically expressed in E. coli and purified via affinity chromatography. While not commercially available for D. psychrophila , homologs from Burkholderia pseudomallei and Pseudomonas fluorescens share similar production workflows .

Key Challenges and Solutions

ChallengeSolution
Low SolubilityUse of stabilizing agents (e.g., trehalose, glycerol) during purification
Cold AdaptationD. psychrophila’s psychrophilic nature may influence protein stability
Functional ActivityAssayed via ATP-dependent lipid A flipping in proteoliposomes

Role in Lipid A Biosynthesis

  • Essential in E. coli: Conditional deletion of msbA leads to LPS accumulation on the inner membrane and growth cessation .

  • Dephosphorylation Dependency: In Francisella, MsbA activity is required for lipid A 1-dephosphorylation, which confers resistance to polymyxins .

Applications and Future Directions

While D. psychrophila MsbA is not yet utilized therapeutically, homologs are studied for:

  1. Antibiotic Targeting: Inhibiting MsbA disrupts LPS export, potentiating Gram-negative bacterial susceptibility to antibiotics .

  2. Vaccine Development: Lipid A modifications by MsbA-dependent enzymes influence immune recognition .

  3. Biotechnological Tools: Recombinant MsbA may aid in lipid A purification or synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
msbA; DP2634; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-572
Protein Length
full length protein
Species
Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Target Names
msbA
Target Protein Sequence
MTNKEIIKRLYHEIIPYKIPLFIAMFAMIVVAALTGAQAYLVKDLLDKIFMEKDVFFLQI LPLIIIAIFFTKGVLYYTYAIILERVGQSIIRDFRLKIFAHIHRQSLSFFHNTPTGTLIS RVLSDVALMQQAVSTVIIQLLRDFFQVIFLLGVIFYMNWKLALICFLIIPLAAIPIVKFG KIFRKLSTKTQEETAEVSNMLHETISGSRIVKAFCREDYEVERFHRQVETLFTITMKNAK YRVFQSPLMEIIGGFAVAGIIWVGGSEVINGSATPGTFFAFLTAMITAYDPVKRVSQVNS TIQQGLASAQRVFAILDIKPEIEDKPEATSLAPFKESIEFHDVSFSYGTEKILSHINLKV PAGEALAIVGPSGGGKTTLTNLIPRFIDLQEGSITIDGTDIRDVTTNSLRNQIAMVTQQT ILFNDTIRNNIAYGKDSCTEEEIRRAAKAAHALTFIEELPNGFDTALGEGGAKLSGGQRQ RISIARALLADAPILILDEATSALDTESEREVQKALENLMQNRTTFVIAHRLSTIKNASR IVVVKKGKIVEEGSHEELLKLEGEYQLLYNMQ
Uniprot No.

Target Background

Function
This protein plays a role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore in the inner membrane, and the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: dps:DP2634

STRING: 177439.DP2634

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Desulfotalea psychrophila and why is it significant for research?

Desulfotalea psychrophila is a marine sulfate-reducing delta-proteobacterium with the remarkable ability to grow at temperatures below 0°C. As an abundant member of microbial communities in permanently cold Arctic marine sediments, particularly off the coast of Svalbard (79°N, 11°E), this organism plays a significant role in global carbon and sulfur cycles . D. psychrophila grows optimally at 10°C but maintains functionality at temperatures as low as -1.8°C, making it a true psychrophile ("cold-loving") . With the completion of its genome sequence, D. psychrophila expanded the temperature range for organisms with sequenced genomes to a new minimum, offering unique insights into cold adaptation mechanisms. Its genome consists of a 3,523,383 bp circular chromosome containing 3,118 predicted genes, supplemented by two plasmids (121,586 bp and 14,663 bp) . Studying proteins from this organism, including MsbA, provides valuable knowledge about molecular adaptations that enable biological processes to function effectively at low temperatures.

What is the functional role of MsbA in bacterial systems?

MsbA is an essential ATP-binding cassette (ABC) transporter in Gram-negative bacteria that performs the critical function of transporting lipid A and lipopolysaccharide from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . This transport process is vital for maintaining the integrity of the outer membrane, which serves as a protective barrier against environmental threats and antimicrobial compounds. As an ATP-dependent transporter, MsbA couples ATP hydrolysis to the movement of these complex lipid substrates across the membrane barrier. The protein operates through conformational changes between inward-facing and outward-facing states, as revealed by structural studies of MsbA from other bacterial species, such as Salmonella typhimurium . The essentiality of MsbA for bacterial survival makes it not only a fascinating subject for basic research but also a potential target for antimicrobial development.

What expression systems are most effective for producing functional recombinant D. psychrophila MsbA?

When expressing recombinant D. psychrophila MsbA, researchers should carefully consider expression systems that accommodate the cold-adapted nature of this protein. E. coli-based expression systems with cold-inducible promoters (such as the cspA promoter) can provide advantages when expressing psychrophilic proteins. Temperature management during expression is critical—induction at lower temperatures (15-20°C) often yields better results for cold-adapted proteins by allowing proper folding while maintaining sufficient expression levels.

For membrane proteins like MsbA, specialized E. coli strains such as C41(DE3) or C43(DE3), which are engineered to better tolerate membrane protein overexpression, often produce higher yields of functional protein. Additionally, fusion tags such as maltose-binding protein (MBP) can enhance solubility while preserving the native conformation of the transmembrane domains.

The choice of detergent for extraction and purification represents another critical parameter. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are often preferred for maintaining the functional integrity of membrane transporters like MsbA. Throughout the purification process, maintaining optimal buffer conditions is essential—typically including glycerol (20-50%) for stability, as reflected in the storage conditions for commercially available recombinant D. psychrophila MsbA .

What are the recommended storage conditions for maintaining activity of recombinant D. psychrophila MsbA?

Optimal storage of recombinant D. psychrophila MsbA requires conditions that preserve both protein stability and functional integrity. Based on available information for recombinant preparations, the protein is typically stored in a Tris-based buffer containing 50% glycerol, which has been specifically optimized for this protein . For short-term storage, keeping working aliquots at 4°C for up to one week is recommended. For longer periods, storage at -20°C is suitable, while extended preservation is best achieved at -80°C .

Given the psychrophilic nature of D. psychrophila proteins, which have evolved to function at low temperatures, it is particularly important to avoid repeated freeze-thaw cycles, as these can significantly impact protein activity and structural integrity . For research applications requiring preserved enzymatic activity, storing small single-use aliquots is advisable to avoid the detrimental effects of repeated temperature fluctuations.

How can researchers assess the ATPase activity of recombinant D. psychrophila MsbA?

The ATPase activity of recombinant D. psychrophila MsbA can be assessed through several complementary approaches, each offering distinct advantages for different research questions:

  • Colorimetric Phosphate Detection Assays: The Malachite Green assay provides a straightforward method for quantifying inorganic phosphate release during ATP hydrolysis. This approach allows for high-throughput screening and kinetic analysis across various temperature conditions, making it particularly valuable for studying temperature-dependent activity profiles of psychrophilic MsbA.

  • Coupled Enzyme Assays: Using a pyruvate kinase/lactate dehydrogenase coupling system enables real-time monitoring of ATPase activity by linking ATP hydrolysis to NADH oxidation, which can be measured spectrophotometrically. This method offers superior temporal resolution for studying reaction kinetics.

  • Radiolabeled ATP Hydrolysis: For highest sensitivity, assays utilizing [γ-32P]ATP can detect even minimal ATPase activity, which may be particularly valuable when comparing wild-type and mutant forms of the protein.

When conducting these assays with D. psychrophila MsbA, temperature control becomes especially critical. Measuring activity across a range of temperatures (0-30°C) allows researchers to establish the temperature profile and identify the optimal temperature for activity, which is expected to be significantly lower than for mesophilic homologs. Additionally, comparing kinetic parameters (Km, kcat, kcat/Km) between psychrophilic D. psychrophila MsbA and mesophilic counterparts provides valuable insights into cold adaptation mechanisms.

How does the structure of D. psychrophila MsbA compare to mesophilic homologs?

While no direct structural comparison between D. psychrophila MsbA and mesophilic homologs is provided in the search results, comparative analysis can be inferred based on general principles of cold adaptation and the available structural information for MsbA from Salmonella typhimurium .

Psychrophilic proteins typically display structural adaptations that enhance flexibility at low temperatures, which is often achieved through:

  • Reduced Core Hydrophobicity: Psychrophilic proteins often contain fewer hydrophobic residues in their core, resulting in weaker hydrophobic interactions that maintain flexibility at low temperatures.

  • Decreased Arginine/Lysine Ratio: A lower Arg/Lys ratio is commonly observed in cold-adapted proteins, as lysine provides more flexibility compared to arginine.

  • Fewer Proline Residues in Loops: Reduction of proline content in loop regions enhances chain flexibility.

  • Reduced Salt Bridges and Hydrogen Bonds: Fewer electrostatic interactions contribute to increased molecular flexibility.

When examining the specific case of MsbA, structural studies of S. typhimurium MsbA revealed a large amplitude opening in the transmembrane portal that allows lipid A to pass from its site of synthesis into the protein-enclosed transport pathway . This creates a "trap and flip" mechanism for lipid transport. In D. psychrophila MsbA, we would expect modifications to this basic structural framework that enhance flexibility and catalytic efficiency at low temperatures while potentially sacrificing thermal stability.

What are the hypothesized cold adaptation mechanisms in D. psychrophila MsbA?

Based on studies of psychrophilic enzymes and the biology of D. psychrophila, several cold adaptation mechanisms can be hypothesized for its MsbA protein:

  • Enhanced Catalytic Efficiency at Low Temperatures: D. psychrophila MsbA likely exhibits higher kcat values at low temperatures compared to mesophilic homologs, compensating for reduced molecular collision rates in cold environments.

  • Modified ATP-Binding Pocket: The ATP-binding site may feature adaptations that lower the activation energy for ATP hydrolysis at cold temperatures, potentially through altered interactions with the nucleotide substrate.

  • Increased Flexibility in Transmembrane Domains: Greater flexibility in the transmembrane regions would facilitate the conformational changes required for substrate transport at low temperatures.

  • Lipid Bilayer Adaptations: The function of MsbA is closely linked to membrane properties. D. psychrophila likely incorporates increased proportions of unsaturated and branched-chain fatty acids in its membranes to maintain fluidity at low temperatures, and its MsbA may have co-evolved to function optimally in this modified lipid environment.

  • Cold-Specific Regulatory Mechanisms: D. psychrophila's genome encodes nine putative cold shock proteins and nine potentially cold shock-inducible proteins , suggesting sophisticated cold-responsive regulatory networks that might influence MsbA expression and function.

The presence of more than 30 two-component regulatory systems in D. psychrophila further suggests complex environmental sensing mechanisms that may modulate MsbA function in response to temperature fluctuations.

How does lipid A transport differ between psychrophilic and mesophilic bacteria?

Lipid A transport in psychrophilic bacteria like D. psychrophila must overcome unique challenges posed by low-temperature environments, including:

  • Membrane Fluidity Challenges: At low temperatures, membrane fluidity decreases significantly, potentially hindering the lateral movement of lipid A within the membrane and its accessibility to the MsbA transporter. D. psychrophila likely compensates through membrane composition adjustments and potential adaptations in the lipid A-binding pocket of MsbA.

  • ATP Hydrolysis Kinetics: The energetics of ATP hydrolysis that powers the transport process must be optimized for efficiency at low temperatures, possibly through modifications of the nucleotide-binding domains.

  • Conformational Transition Rates: The rate of conformational changes between inward-facing and outward-facing states—essential for the transport mechanism—would be naturally slowed at low temperatures. Psychrophilic MsbA likely features structural adaptations that lower the activation energy for these transitions.

Analysis of the genome of D. psychrophila revealed the presence of TRAP-T systems as a major route for the uptake of C4-dicarboxylates, suggesting specialized transport mechanisms adapted to cold environments . While this doesn't directly relate to MsbA function, it demonstrates D. psychrophila's evolved transport adaptations to its psychrophilic lifestyle.

How can studies of D. psychrophila MsbA contribute to antimicrobial development?

The essential nature of MsbA in lipid A transport makes it a promising target for antibacterial drug development. D. psychrophila MsbA offers unique advantages as a model system for several reasons:

  • Comparative Structural Analysis: Studying structural differences between psychrophilic and mesophilic MsbA proteins can reveal conserved functional elements that might serve as targets for broad-spectrum antibiotics. The lipid A binding site, if highly conserved, could represent an attractive target with lower likelihood of resistance development.

  • Cold-Active Inhibitor Screening: The cold-active nature of D. psychrophila MsbA enables screening for inhibitors at low temperatures, potentially identifying compounds with unique binding properties that might be missed in screens using mesophilic homologs.

  • Environment-Specific Antimicrobials: Understanding the specific adaptations of psychrophilic MsbA could lead to the development of antimicrobials effective in cold environments, which could have applications in food safety, marine environment protection, or medical settings where psychrophilic bacteria may pose problems.

  • Resistance Mechanisms: By studying multiple MsbA variants including psychrophilic ones, researchers can better understand potential resistance mechanisms and design inhibitors less susceptible to resistance development.

The genome sequence of D. psychrophila revealed many striking differences when compared to the hyperthermophilic archaeon Archaeoglobus fulgidus, the only other sulfate reducer with a published genome at the time of the study . These differences highlight the diverse adaptations of extremophiles and suggest that comparative studies of transport proteins like MsbA across the temperature spectrum could reveal new targets for antimicrobial development.

What biotechnological applications might emerge from research on D. psychrophila MsbA?

Research on D. psychrophila MsbA could lead to several innovative biotechnological applications:

  • Cold-Active Biocatalysts: The cold-adaptation mechanisms identified in D. psychrophila MsbA could inform the engineering of other enzymes and transporters for enhanced activity at low temperatures. This has potential applications in cold-environment bioremediation, food processing, and detergent formulations.

  • Membrane Protein Expression Systems: Insights from the successful expression and stability of psychrophilic membrane proteins could improve expression systems for challenging membrane proteins of biotechnological or pharmaceutical interest.

  • Lipid Engineering: Understanding how D. psychrophila MsbA interacts with lipids at low temperatures could inform strategies for lipid nanoparticle design for cold-stable drug or vaccine delivery systems.

  • Bioenergy Applications: D. psychrophila contributes to carbon and sulfur cycles in permanently cold marine sediments . Studying its transport mechanisms could inform the development of cold-active microbial fuel cells or bioremediation strategies for cold environments contaminated with organic pollutants.

  • Structural Biology Methods: Techniques optimized for studying cold-active proteins like D. psychrophila MsbA could advance structural biology methodologies for working with thermolabile proteins more generally.

The unique metabolic properties of D. psychrophila, including its ability to use various organic acids, alcohols, and amino acids as growth substrates while reducing sulfate to sulfide , point to a versatile metabolism that could be harnessed for biotechnological purposes, with MsbA playing a supporting role in maintaining membrane integrity under these conditions.

What structural biology techniques are most suitable for studying D. psychrophila MsbA?

Several complementary structural biology techniques offer valuable insights into the structure and function of D. psychrophila MsbA:

  • X-ray Crystallography: The successful determination of MsbA structures from other bacteria, including the 2.8-Å resolution structure of S. typhimurium MsbA , suggests this technique could be applicable to D. psychrophila MsbA. Temperature control during crystallization becomes especially important for psychrophilic proteins to maintain native conformations.

  • Cryo-Electron Microscopy (Cryo-EM): This technique offers advantages for membrane proteins like MsbA, particularly in capturing multiple conformational states. For D. psychrophila MsbA, cryo-EM's inherent low-temperature conditions align well with the protein's native operating temperature.

  • Molecular Dynamics Simulations: Computational approaches can provide insights into the dynamic behavior of D. psychrophila MsbA within a membrane environment across temperature ranges, revealing cold-adaptation mechanisms at the atomic level.

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): This technique can map protein flexibility and dynamics, which are particularly relevant for understanding cold adaptation in D. psychrophila MsbA.

  • Small-Angle X-ray Scattering (SAXS): SAXS can provide information about the global shape and conformational changes of MsbA in solution under various temperature conditions.

When studying the structure of lipid A-bound MsbA, approaches similar to those used for S. typhimurium MsbA—where putative lipid A density was observed both inside the transmembrane cavity and near an outer surface cleft at the periplasmic ends of the transmembrane helices —could reveal insights into substrate binding and transport mechanisms in the psychrophilic variant.

How can researchers investigate the lipid A transport function of recombinant D. psychrophila MsbA in vitro?

Investigating the lipid A transport function of recombinant D. psychrophila MsbA requires specialized assays that accommodate the unique properties of both the psychrophilic protein and its complex lipid substrate:

  • Reconstituted Proteoliposome Transport Assays: MsbA can be reconstituted into liposomes with fluorescently labeled lipid A analogs to directly measure transport activity across a range of temperatures (0-30°C). This approach allows researchers to quantify the temperature dependence of transport rates and substrate specificity.

  • Fluorescence-Based Binding Assays: Using environmentally sensitive fluorescent lipid A analogs or FRET-based approaches can provide insights into substrate binding dynamics at different temperatures without requiring full transport.

  • Surface Plasmon Resonance (SPR): This technique enables real-time monitoring of lipid A binding to immobilized MsbA and can reveal binding kinetics across temperature ranges.

  • ATPase Activity Coupled to Lipid Binding: Measuring how lipid A binding influences the ATPase activity of D. psychrophila MsbA can provide indirect evidence of functional interactions. Comparing stimulation patterns between psychrophilic and mesophilic MsbA variants reveals adaptation mechanisms.

  • Fluorescence Microscopy with Model Membranes: Using giant unilamellar vesicles (GUVs) containing fluorescently labeled lipids and reconstituted MsbA allows visualization of lipid translocation events at the single-vesicle level.

For all these functional assays, temperature control is critical. Performing parallel experiments with mesophilic MsbA homologs provides valuable comparisons that highlight cold-adaptation features. The lipid composition of model membranes should also be considered, as D. psychrophila may have evolved to function in membranes with higher proportions of unsaturated fatty acids typical of psychrophilic bacteria.

What evolutionary insights can be gained from studying MsbA in extremophilic organisms?

Studying MsbA in extremophiles like D. psychrophila offers valuable perspectives on protein evolution in response to environmental challenges:

  • Convergent vs. Divergent Evolution: Comparing MsbA proteins from psychrophiles, mesophiles, and thermophiles can reveal whether similar adaptive solutions evolved independently (convergent evolution) or whether adaptations represent divergence from ancestral forms.

  • Essential vs. Variable Regions: Cross-species comparison identifies highly conserved regions that likely serve essential functions, versus variable regions that may reflect environmental adaptations. The nucleotide-binding domains of ABC transporters tend to be more conserved than the transmembrane domains, which might show greater adaptation to different temperature regimes.

  • Selective Pressure Analysis: Calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) in MsbA genes across bacterial species from different temperature niches can identify regions under positive selection during adaptation to cold environments.

  • Horizontal Gene Transfer Assessment: Analyzing whether horizontal gene transfer played a role in the acquisition of cold-adapted versions of essential genes like MsbA provides insights into bacterial adaptation strategies.

The genome analysis of D. psychrophila revealed many striking differences when compared to Archaeoglobus fulgidus, a hyperthermophilic sulfate reducer . This suggests that adaptation to temperature extremes drives significant genomic divergence. D. psychrophila's genome encodes more than 30 two-component regulatory systems , indicating sophisticated environmental sensing mechanisms that likely influence the expression and function of proteins like MsbA in response to environmental conditions.

How does D. psychrophila MsbA relate to the organism's ecological role in carbon and sulfur cycles?

D. psychrophila plays a significant role in carbon and sulfur cycling in permanently cold marine sediments . The connection between MsbA function and these ecological roles can be understood through several perspectives:

  • Membrane Integrity in Cold Environments: As an essential transporter for lipid A, MsbA ensures proper outer membrane assembly, which is critical for D. psychrophila's survival in cold marine sediments. This membrane integrity enables the organism to maintain its metabolic functions contributing to carbon and sulfur cycling.

  • Energy Conservation: ABC transporters like MsbA require ATP for function. In cold environments where energy may be limiting, efficient operation of energy-consuming processes becomes critical. D. psychrophila MsbA likely evolved to function with optimal energy efficiency at low temperatures.

  • Adaptation to Substrate Availability: D. psychrophila utilizes various organic acids, alcohols, and amino acids as growth substrates while reducing sulfate, thiosulfate, and sulfite to sulfide . The cell's ability to process these diverse substrates depends on functional membrane systems maintained in part by MsbA.

  • Response to Environmental Fluctuations: Arctic marine sediments may experience seasonal variations in temperature and nutrient availability. The sophisticated regulatory systems in D. psychrophila, including more than 30 two-component regulatory systems , likely modulate MsbA expression and function to optimize membrane performance under changing conditions.

The rates of sulfate reduction in Arctic marine sediments are comparable to those in temperate environments , indicating that psychrophilic sulfate-reducing bacteria like D. psychrophila have evolved highly efficient cellular machinery, including transport systems, that perform effectively despite the challenges posed by low temperatures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.